ELF>p}@Pp'@8 @]]```EE\ \ s%s%s%@&&& $$Std Ptd:":":"JJQtdRtds%s%s%`\`\GNUGNU7 6EJm $Q!x`|<ҤB^??RZ B ln<  8 QF 4   a  `mZ Y e -R  Z du | > 6 K  w$ 4X[  8\  n) ,  $|?F" {CUJ w @ sB &h ` 1 M Z n# _[ "  @se* j! + 0S 0   OMA+ m g]}{  < 7 04D&t+     "('N S;xTyGa : L  Se (n    6} 0 M 4  @c__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizestrrchr__stack_chk_failstrlenstrncmpstrcmplstat64__isoc99_sscanffopen64strstr__getdelimfclose__errno_locationstrerrorusleepmemcpystrdupdm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroymemccpydm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_handler_get_dso__assert_failstrncpycallocstrcasecmpmemset__ctype_b_locgetenvctime_rcloselogopenlogunamefcntl64stdinselabel_closepthread_mutex_lockpthread_mutex_unlockstdoutsetlinebufgetpagesizeio_destroyio_submitio_geteventsmalloclseek64strchrfputc__fprintf_chkstrspnstrcspnmemmove__ctype_toupper_locstrtodstrtollfgetsumasksd_id128_get_machine_app_specificopendirreaddir64closediralphasort64scandir64setlocaleudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirlocaltimestrftimerename__snprintf_chk__memcpy_chk__sprintf_chk__ctype_tolower_locmemcmpunlinkctimegetpidfputsfflushfilenofsyncstrtouldirfdunlinkatflockstrtoludev_device_new_from_devnumudev_device_get_is_initializedreadlinkioctludev_device_get_property_valuedirname__xpg_basenameblkid_new_probe_from_filenameblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_safeprobeblkid_probe_lookup_valueblkid_free_probestrtoullblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_do_probeblkid_probe_step_backnvme_get_nsidposix_memalignnvme_identifysnprintfsetmntentgetmntentendmntentreallocferror__vfprintf_chk__vsnprintf_chkgetcstderrfeoffwriteversionsort64accessfdopenrand_r__strncpy_chk__vsyslog_chksd_journal_printv_with_locationabortfstat64io_setupsysconfdup2qsortsysinfogetrlimit64mallinfo2mlockallmlockmunlockallmunlockstrncasecmplocaltime_rmktimewaitpidsigprocmasksigactionsigaddsetsigismembersigdelsetudev_newudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_unrefgetprioritysetpriorityforkwait4execvplockf64sd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namememchrsymlinkrmdirputchar__printf_chkoptargoptindgetopt_longnanosleepsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_initlvm2_runsetenvsd_journal_send_with_locationlvm2_init_threaded__fdelt_chkselectmknodgeteuidclock_gettime__isoc99_fscanfsemctlsemgetsemopgmtime_rstrndupmalloptsyscallsetvbufrewindnl_langinfotmpfile64pipesigfillsetgethostnameprlimit64dm_event_unregister_handlerdm_event_register_handlerstrcpyisspacesocketconnectselabel_lookupsetfscreateconfreeconis_selinux_enabledselabel_openchownlibdevmapper-event.so.1.02libdevmapper.so.1.02libsystemd.so.0libblkid.so.1libnvme.so.1libaio.so.1libselinux.so.1libudev.so.1libc.so.6liblvm2cmd.so.2.03BaseLIBNVME_1_0LIBAIO_0.4LIBAIO_0.1LIBSELINUX_1.0LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.7GLIBC_2.3.4GLIBC_2.2.5                      K   0t0 q0     =   m Pb b# b2 bA   #P } @A \ A g A r  }   ii    ii  ii ti ui  s%s%s%s% s%s%s%8t%ڈpt%t%t%t%ܵu%(u%`u%xu%u%(u%v%v%aPv%@hv%Uv%a w%@w%hXw%qw%w%w%w%ph0x%Hx%0x%x%x%a^x%`x% y%x8y%#Hy%Xy%py%y%y%Ky%y%/y%Cz%h(z% 8z%I`z%xz%Pz%Z{%{%w({%P{%h{%x{%F{%x{%{%|%(|%@|%(X|%h|%ζ|% |%ݶ|%|%}%F0}%PH}% }%0}%}%7}%}%}%P ~%X8~%XH~%Pp~%p~%~%J~%@L~%f~%~%(%p8%(x%%o%%P%h%%X%%%Ʒ%۷@%(X%%%%;%%0%H%7%`%JЂ% %a %x 8%Rp%H %h%؃%z%(%`%Px%Ȅ%%x%޸P%h%%%%%@%pX%% % %%/%@0%H%!%!%x%Ї%%%[ %&8%'p%@'%s%!%'%؈%%'(%8%!`%p(x%%)ȉ%ù%`*%ҹP%*h%x%%0+%%`-%.@%@.X%%.%&%H/%5%"0%/H%HX%d%00%lЌ%H2%z%p %28%p%3%%04؍%%4(%κ8%`%5x%%6Ȏ%%7%P%8h%*%@9%D%9%Y@%9X%r%0:%%;%0%;H%%<%Б%P=%Ļ %=8%ڻp%?%%@ؒ%%;%B(%`%Ex%%8Gȓ%$%G%7(%HP%Kh%Tx%L%L%eȔ%8M%`M%U5@%PX%{%P%%R% 0%RH%%S%Ж%S% %S8%p%T%%Tؗ%{%Q%U(%U`%Vx%Ș%ļؘ%xV%V%Ҽ(%WP%Xh%x%W%X%%X%%0(%@%PYX%B%Y%%pȚ%%Z%0%`ZH%%Z%&Л%Z%3 %Z8%9p%`[%>%&""%[؜%D%[(%X`%]x%U%]ȝ%_%E(%h%p%%%(%@%X%˽h%ʽx%Ͻ%^%ٽ%0%^H%%%-%9%G %(_8%Zp%_%q%aء%}%(%`%ax%bȢ%%b%Ͼ(%8%P%ch%%h%!ȣ%8أ%?%i%X%[(%o@%kX%n%n%Ȥ%%o%H%%ٿХ%q% %Hq8%p%r%%rئ%%(t(%)8%(`%ux%A%W%l%wȧ%}ا%%%0y%(%8%P%yh%x% %$%z%7Ȩ%{%{%J%^@%|X%ah%^%(}%v%`}%0%~H%X%h%%%%%Ъ%H% %8%O %8%bH%{X%p%%%{%ȃث%%^%`(%8%^`%x%%%%ЄȬ% ج%^%H%3P%h%Ix%Z%j%x%wȭ%%؆%@%X%0%P%Ȯ%% %0%H%%%Я%0% %8%p%%%ذ%%E%(%+`%hx%=%0ȱ%L%ؘ%\P%h%}%%m%%@%X%%0%x%%%0%H%X%;%8%%д%%%G %@8%H%&p%%/%q% %pص%J%(%h`%x%% ȶ%%%P%ph%%X%%%@%8X%%%%p%0%H%*X%:%%Hй%%C %8%Xp%%n%غ%%@(%`%x%%Ȼ%ػ%%%P%h%%%X%%%giH% %%о%% %8%(H%(p%h%<%ؿ%D%(%M`%Px%`%%%V%"9% %jP%Xh%s%%z%%@%X%h%%%%%%% 0%XH%X% %%%%X%% %@8%H%p%p%0%9%%A%X%(%J8%`%`x%[%d%%l%H%x%u(%P% h%x%%%% %X%%@% X%h%%%%0%%%x0%H%X%%%%%% % %x8%H%0p%%!%J%x%Z%9%(%h8%d`%xx%v%%%%%x%(%P%h%%%%%%H@%pX%h%%%%%%0%H%gq X%!%%=%I%H%~q %! %H 8%pH%gX%zp%h %% %>J % (%`% x%%p%%%P%%0 % % %p % % %` (% p% x% %0 %@ %@ % % % % %0 % % %B %y %p? (%s 8%\ @%Q H%0 P%p} X%Y `%`f h%@ p%`d x%d % e %`%%%%Pw%r%:%% 8%@%`WH%@;%Pw%q%:%}%%`W%@; % 0% 8% @% H% X%@ `% x%0 % % %P % % % % %0 % % %@ % %0 % (% p%:x%H%:%=%0[%T% V% ;%:%N %:(%b8%XX%`U`%Vh%0;%%%%%.%F%_H%P%%O(%Y@%bX%~p%%%%%%%Θ%ܘ0%H%`%(x%X%%%%%#%8 %J8%P%ch%%%%%%љ%ߙ%(%@%X% p%%(%pb%b%b%c%F%R%[0%[%R%c%n%u%z %8%P%h%%u%z%0%H%`%nx%%%%'%%% %8%/P%;h%%K%[%k%%yp%0x%%0%%%%%p%%P*%p*%0%p %(%@%@H%CP%HX%0`% h%@p%x%%@%p%P%`%%%%pF%F%`%%% %%%0%%%%@@%?%0%%P%pF%` %00%% $%"%@% H% P% X%P `%P h%n p%@ x% %` % % % % % %@ %P %n % %0 % % % % % % %p % %p % (% 0%Б 8% @% H% P% X% `% h% p% x% % %` % % % %И %0 % % %@ % %P % % % %P % % %` %p % (% 0% 8% @% H% P% X% `% h%` p% x% % %@ % % % % % % %` % % % % % % % %В % % %` % (% 0% 8% @% H% P% X% `% h% p% x% % % % % % % %dJ%J%J0%JP%Jp%J%J%J%J%J%J0%JP%Jp%J%J%J%J%$K%0K0%TKP%TKp%TK%lK%lK%lK%K%K0%KP%Kp%K%K%K%K%K%K0%LP%Lp% L% L%,L%,L%8L%8L0%DLP%PLp%PL%\L%\L%hL%hL%tL0%tLP%Lp%L%L%L%L%L%xB%G%G%G %G(%G0%G8%H@%HH%HP%HX%,H`%5Hh%DHp%VHx%bH%oH%}H%H%H%H%H%H%H%H%H%H% I%I%"I%/I%@ %G %C (%`D 8% H%K P%`I X%b `%Pe h%@ p%0d x%d %d %(%L^%(%(%L^%(%(%L^(%(0%(8%L^X%(`%(h%L^%(%` %` %(%L^%(%0U%V^%f^%0U %E(%x^0%^H%EP%;h%8Z%RV%^%^% %RV%e%&""% %e%HV%%^(%HV0%0h8%@X%0Z`%0hh%C%xI%0h%@%0Z%0h%C%xI%0h%@%0Z %0h(%CH%xIP%0hX%@x%0Z%0h%C%xI%U%mV%@%0Z%U%mV%C(%xI0%?8%@X%0Z`%?h%C%xI%U%%%@%0Z%U%%%C%xI%*5%@8%0Z@%*5H%Ch%xI%U%^%^%@%0Z%U%^%^%C%xI%U%^%^%@8%0Z@%UH%^P%^X%Cx%xI%!%@%0Z%!%C%xI%U%& %@%0Z %U(%& 0%CH%xI`%Uh%o p%@%0Z%U%o %C%xI%V%8!%V%@%0Z %V(%8!0%V8%CX%xI`%^h%8!p%^x%@%0Z%^%8!%^%C%xI%V%8!%V%@%0Z %V(%8!0%V8%CX%xI`%8!h%@%0Z%8!%C%xI%U%^%@%0Z%U%^%C(%xI@%sUH%p P%@h%0Z%sU%p %C%xI%hU%@%0Z%hU%C%xI%V%@8%0Z@%VH%Ch%xI% V%V%@%0Z% V%V%C%xI&UU&cU&@(&0Z@&UUH&cUP&Ch&xIp&V&I&e&&""& &e&HV&&^&HV&%V&@8&0Z@&%VH&Ch&xIp&hex&@&0Z&he&C&xI&MU&@&0Z&MU&C(&xI0&8&@X&0Z`&h&C&xI&BU&@&0Z&BU&C&xI&&@&0Z &(&CH&xI`&r h&C p&@&0Z&r &C &C&xI&&@&0Z&&C(&xI0&8&@X&0Z`&h&C&xI&6U&@&0Z&6U&C&xI&&b &L^&^@&fH&8P&\X&u`&8h&vp&jx&&~!&@ & &` & & @& P& X& `&p h&P p& x& & & &p &~ &P & & 0&Џ 8& @& H&P P& X&` `& &I&&&}&&&&&(&&&&&(&&&`&&(&P&&0&&((& &0&&8&(H&&P&&X&(h&&p&&x&(&&&`&&(&@&& &&(&&&&&(&&&&&( && && &(( &&0 &`&8 &(H &P&P &0&X &(h & &p &&x &( && && &( && && &( && &p& &( &`& &@& &( &0& && &(( &&0 &&8 &(H &&P &&X &(h &&p &p&x &( &`& &@& &( & & && &( &% &% &( &% &% &( &`% &@% &(( &0%0 &%8 &(H &%P &%X &(h &%p &%x &( &% &% &( &`% &@% &( & % &% &( &% &% &( &% &% &(( &%0 &`%8 &(H &P%P & %X &(h &%p &%x &( &% &% &( &% &`% &( &P% & % &( &% &% &( &% &% &(( &%0 &`%8 &(H &@%P & %X &(h &%p &%x &( &% &% &( &% &% &( &p% &@% &( &0% &% &(&%&%&((&%0&%8&(H&`%P&@%X&(h&0%p&%x&(&%&%&(&%&%&(&%&`%&(&P%&0%&(& %&%&((&%0&%8&(H&%P&%X&(h&p%p&P%x&(&@%& %&(&%&%&(&%&%&(&%&%&(&%&`%&((&P%0&0%8&(H& %P&%X&(h&%p&%x&(&%&%&(&`%&P%&(&@%& %&(&%&%&(&%&%&((&%0&`8&(H&%P&PX&(h&%p&`%x&(&P%&0%&(& %&%&(&%&%&(&%&%&(p&/ x&_&% &}0&1 8&}&P2 &(~&2 &X~P&1 X&~&v &_&v &_p& x&~&@ & 0& 8&P& &'_& &E_P&p X&& && &p& x&& &00& 8&[_& &X& &P&w X&&\ &Ѐ&\ &p&E x&@&pG &s_0&@q 8&h&U &_&3 &P&P4 X&&pJ &(&P< &hp&= x&&P? &0&@ 8&0&b &p& &P &pV X & &V &8!&0W !&xp!&j x!&_!&m !&_0"&m 8"&"&PB "&"&@C "& P#&* X#&h#&. #&$&' $&p$&0+ x$& $& ( $&h0%&, 8%&%&( %&%&, %&8P&&p) X&&&&- &&Ї'& '&_p'&0V x'&('& W '&X0(& r 8(&(&s (&(&` (&ЈP)& X)&)& )&_*&\ *&`p*& x*&0*& *&p0+&\ 8+&+& +&`+&p +&+`P,&P X,&,&0 ,&-& -&C`p-&`h x-&8-&h -&0.&h 8.&Ȋ.&@i .&.&@i .&P/& c X/&]`/&`c /&q`0&c 0&`p0&c x0&`0& d 0&`01&`d 81&`1&d 1&`1& 1&`P2&S X2&`2&0 2&3&! 3&`p3& x3&3& 3& 04& 84&a4& 4&h4& 4&P5&` X5&5&] 5&6&H 6& p6&] x6&H6&d 6&/a07& e 87&Ha7&`e 7&x7&e 7&faP8&0 X8&8&X 8&a9&p0 9&_p9&f x9&ȍ9&pR 9&a0:&p 8:&a:&@ :&a:&L :&P;&`M X;&8;&@U ;&a<&E <&xp<&K x<&a<&e <&0=&K 8=&=&0 =&=& =& P>& X>&P>& >&p?&R ?&p?&R x?&ȏ?& ?&_0@&pg 8@&@&g @&(@&E @&XPA&E XA&A& A&aB&@ B&pB&t xB&bB&u B&0C&W 8C&aC& C&_C&0Q C&aPD& XD&D&P D&*bE& E&:bpE& xE&SbE& E&(0F& 8F&jbF& F&bF& F&bPG& XG&bG&H G&PH&@L H&xpH&  xH&H&  H&0I& 8I&I& I&I&@D I&0PJ&R XJ&J&R J&`K&R K&pK&R xK&ȒK&R K&b0L&T 8L&L&U L&bL&V L&bPM&R XM&(M& M&_N&p N&ppN&T xN&N&pT N&ȓ0O&O 8O&O&0N O&0O&T O&pPP&p XP&bP&0R P&Q&@R Q&ДpQ&`^ xQ&Q&@_ Q&80R&R 8R&cR&` R&pR&_ R&PS&R XS&ЕS&@D S&T&@D T&HpT&I xT&T&W T&Ж0U&` 8U&U&a U&@U& U&hPV& XV&V&a V&ȗW&S W&pW&H xW&@W& R W&0X&PI 8X&ИX&S X&X& X&_PY& XY& Y& Y&Z& Z&pZ& xZ&@Z& Z&x0[&] 8[&[&T [&[& [&P\&n X\&'c\&0z \&P]&0{ ]&xp]& x]&]&O ]&ț0^&W 8^&^&0} ^&;c^&P ^&P_&PQ X_&@_&pX _&h`&X `&p`&pY x`&Vc`&Y `&0a&pZ 8a&a&Z a&a&p[ a&HPb&[ Xb&xb&` b&c&0| c&؝pc& xc&c&R c&80d&R 8d&lcd&Q d&hPe&p\ Xe&e&0Q e&cpf&R xf&cf&0Q f&c0g&0Q 8g&cg&0Q g&cg&0Q g&cPh&0Q Xh&dh&0Q h&di&0Q i&)dpi&0Q xi&Bdi&\ i&Od0j&\ 8j&Vdj&Fj&cdj&0~ j&gdj&vdj&P~ j&zdj&vdj&`~ k&dk&vdk&`~ (k&0k&vd8k&`~ Hk&dPk&dXk&p~ hk&dpk&dxk&~ k&dk& ek&~ k&dk& ek&~ k&(k&(k&ek&ek&~ l&(l&((l&(e0l&!"8l&~ Hl&(Pl&(`l&hl&pl&l&ڈl&Pl&p l&Sl&l&@Ql&\l&Pl& l&gm&m&0 m&o(m&z8m&0QHm&Pm&`m&Hpm&xm&m&m&ܥm&m&{m&im&m& m&m&n&n&n&0(n&8n&ʥ@n&Pn&@`n&hn&`xn&n&%n&Pn& n&Dn&/n&n&Gn&n&fo&So&[o&(o&q0o&x@o&PPo&Xo&ho&xo&o&o&o&_fo&@o&lo&o&o&so&ӥo&p&ep&B p&p0p&P@p&Hp&Xp&lhp&pp&p&p&p&p&@ p&$p& p& p&p&Pp&q&q& q& 0q&E8q&Hq&PXq&`q&pq& q&q&q&q&*q&(q&Pq&.q&5q& q&Or&Xr& r&u(r&X8r& Hr&Pr&`r&0pr&gxr&r&r&~r&r& br&r&r&cr&r&8s&s&s&X(s&8s&@s&Ps&p`s&-hs&xs&;s&s&s&pXs&s&s&s&s&s&^t&t&0t&(t&0t&@t&gPt&Xt&`ht&xt&$t&,t& t&@t&t&Pt&Jt&t&0t&hft&Su&0u&j u&s0u&`@u&Hu&Xu&Phu&pu&u&u&u&(u&0u&h v&Pv&v&Pv&xv&w&P@w&pw&w&w&x x& 0x& `x&h x&Px&8x& y&Py&py&y&y&z&@@z&pz&pz&z&H{&0{& `{&{&H!{&x"{&" |&8#P|&#|&8$|&$|&%}&&@}&x(p}&(}&*}&h,~&P-0~&-`~&`1~&x3~&3~&4 &4P&5&5&%&x6&7@&8p&9&:Ѐ&8:&`:0&x;`&;&<&8=&0> &6P&h>&>&?&@&h@@&Cp&XD&EЃ&F&G0&hG`&G&H&J&(K &KP&L&M&N&N&`O@&Op&@P&PІ&S&T0&U`&@V&V&PW& YP&HY&xY&Y&Z&H[@&[p&H]&]Љ&^&`0&8a`&`e&g& i&i &0jP&k&l&n&0o&p@&Op&p&qЌ&(r&pt0&u`&v&Xw&0x&y &P{P&{&|&~&&@&hp&`&%Џ&h&x0&`&&&Ћ&( &P&H&&؏&8&x@&p&0&В&&0&`&(&h&& &0P&x&0&P&&إ&&X&@&p&@&%И&&0&H`&&h&&P&8&&&@&&HЛ&0&`&&H&H& &P&&&P&&@&Xp&& О& &0&8`&8&& &pP&&& &@&p&0С&(&0&H`&&0&H &P&8&& &p&X&Ф&&P0&`&8ȥ&&p&0&6h&@8p&&8&ئ&7&&иH&и&и&и&``&иh&&м&Ш&6ب&&P&@&H&x&&,&&;&&6 &(&]X&p`&H&&ZȪ&Ъ&j&P&]8&P@&p&x&z&&&&& &P&pX&&и&& Ȭ&H&&0&8&h&p&& 9&ح&9&E&@:&H&@P&&&&&&& (&P0&`&h&&&`Я&`د&&&4H&&&`&`(&8&`H&PX&`h&Px&`&&`&`&`ȱ&`б&$ر&H&05 &`&$&HP&X&&&0&OH&Y`&bx&~&&&س&&& &Θ8&ܘP&h&&(&X&ȴ&&&&#(&8@&JX&p&c&&&е&&&љ&ߙ0&H&`&x& &&(ȶ&iض&@j&V&W&m&l(&j8&0mH&SX&pTh&pnx&pn&pn&0s ط& &&&@&`(&@8& H&`X&`h&x&@&&p,&p,&&ȸ& ظ&`&#&1&$&$(&8&H&X& h&"x&"&& !& !&Pȹ&ع&&&o&o&z(&}8&|H&X&h&&x&0&`&"&&Ⱥ&غ&&&r&&(&8&H&X&h&x&p&@3)& & &&(&(&0& p&x&&&@&) P& X&"9h& p&! &$ &zf&$ &J&B &&S &o!&d &&v && &\(& 0&D @& `& p&Н x& &ȸ & & & &8 & & &e& & & &xf& & 0&P 8&H& P& `& h&_o x& 0&@&@&H&@&P&P&X&P&`&`&h&`&p&&&&&&08&8&@&8&H&H&P&H&& & &(0&(`&`&h&`&&&&&&&&&&&&& & &(& &&(&&&&&&&&&&&& & &(& &0&0&8&0&X&(h&&&U&`&&&X&X&`&X&&&&&&(&&&& & &(& &0&0&8&0&@&@&H&@&P&P&X&P&x&(&&&&& &`&p&(&&&&&&&&&&&&&&&&&&F&O&P&Z&]&_&&&&@&H&P&X&`&h&p&x&& & & & & &&&&&&&&&&&&&&& &(&0& 8&!@&"H&#P&$X&%`&&h&'p&(x&)&*&+&,&-&.&/&0&1&2&3&4&5&6&7&8&9&:&;&<&= &>(&?0&@8&A@&BH&CP&DX&E`&Gh&Hp&Ix&J&K&L&M&N&Q&R&S&T&U&V&W&X&Y&Z&[&\&^&`&a&b &c(&d0&e8&f@&gH&hP&iX&j`&kh&lp&mx&n&o&p&q&r&s&t&u&v&w&x&y&z&{&|&}&~&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&&&&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&&&&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&&&&&&&&&&&&&&&&&&& &(&0&8&@&H&P&X&`&h&p&x&&&HHo%HtH5 h%% h%hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQ%eY%D%]Y%D%UY%D%MY%D%EY%D%=Y%D%5Y%D%-Y%D%%Y%D%Y%D%Y%D% Y%D%Y%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%X%D%}X%D%uX%D%mX%D%eX%D%]X%D%UX%D%MX%D%EX%D%=X%D%5X%D%-X%D%%X%D%X%D%X%D% X%D%X%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%W%D%}W%D%uW%D%mW%D%eW%D%]W%D%UW%D%MW%D%EW%D%=W%D%5W%D%-W%D%%W%D%W%D%W%D% W%D%W%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%V%D%}V%D%uV%D%mV%D%eV%D%]V%D%UV%D%MV%D%EV%D%=V%D%5V%D%-V%D%%V%D%V%D%V%D% V%D%V%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%U%D%}U%D%uU%D%mU%D%eU%D%]U%D%UU%D%MU%D%EU%D%=U%D%5U%D%-U%D%%U%D%U%D%U%D% U%D%U%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%T%D%}T%D%uT%D%mT%D%eT%D%]T%D%UT%D%MT%D%ET%D%=T%D%5T%D%-T%D%%T%D%T%D%T%D% T%D%T%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%S%D%}S%D%uS%D%mS%D%eS%D%]S%D%US%D%MS%D%ES%D%=S%D%5S%D%-S%D%%S%D%S%D%S%D% S%D%S%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%R%D%}R%D%uR%D%mR%D%eR%D%]R%D%UR%D%MR%D%ER%D%=R%D%5R%D%-R%D%%R%D%R%DH% HmL/R1ɺIH531H%H %L H% %L H%h %T H%p H% H% %T H% %L H% H% H% H% H% H% H% H% %L H% H%P H% H% H% H% H% H% %L H% %L H% %L H% H% %T H% H% Db H% %L H% H%X H% H% H% %( H% H% % H% % H% %T H% H% H% %( % H%X H%` H%h H% H%h H% H% H% H% % H% H% H% H% H% H%X H% H% H% %T H% H% % H% H% H% % H% H% % H% H% L% H% iL`S1ɺIH5K\1%L %L H% L$% H% H% %( H% H% H% %T %T %T %L % H% H% %L %L %L %8 %L %( %P %P H% %L %< % % H%0 %L %L H% 1H|$P %8 % %L HD$`HD$hHD$`%L H% H% H% %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L H% %L %L % H%0 H% %( H% %L %L H% H% HD$ H% H% H% H% H% H% H% %d L,% H% H% %L H% H%h H% H% H% H% H% H%h H% H%X H%X H% H% H% H% %< %@ %D H% H% H% H% H% H% H% H% H% %p %H H% H% H% H% H% H% H% H% H% H% %T H%X % H% H% H% %H H% H% H% H% H% H%0 H%  H% H% H% H% H% H% H% H% H% H% H% H% %` %0 H%0 H% % H% %Y % %L % H% H% H% H% %X H% H% H% H% H% H% H% H% H% H% H% H% % H% H% H% % % H% %L H% H% H% H% H% H% H% %L H%X %L % H% H% H% H% H% H% %L H% %L % H% H% H%h H%h H% H% L% H% H% H% H% H%h H% H% H% H% H% H% H% %  H% H% H% %L H% H% H% H% H% H% ~H% 1ʖH% % H% %L H% H% H% %L %  H,% H% H% H% HD$ HD$(HD$ H% H% H% H$H% H% H% H% H% H% H% H% %L H% %L H% H%` H%` %P%tD s%AVAUATUSEt!L> H5T%H=g%HtH=%HK%HtL5Z%H-T%Hx%LH9m^1L%LiLS%HS%H9t=L-DHIs e1MLAS%HXZH9uLiLL51S%S%[%]A\A]A^LfUH=aOHt x8H=?B%*HHtH5KHcu B%]H5G?HDtH5ZH1uA%]A%]DH=)q%H"q%H9tHNA%Ht H=p%H5p%H)HH?HHHtHA%HtfD=p%u+UH=@%Ht H=#Ydp%]wAWAVAUATUSHdH%(H$1HHLL9HD$1Ld$@H$L5 DHCA龀LHPPL@H1HLx8P6IH/LHHPLLU(Lt~u]LH-J Ƨ1L0 1ɺ Hy1H$dH+%(H[]A\A]A^A_fDH4$LLueD[H-f?%LL?%Uf.L1ɺ H-1HAT$uSHL93f.1L:1ɺ H581D$ uH/LHD$SLD$HtQLHPL&LD$LDžLD$`H|$A3E7H-XfDr>%LLLD$$LD$Lg1ɺ #Gd uAATUSHt[]A\HGPHL ٻHLt[]A\H][]A\ff.@AWIAVAUIATUSHHFH@ H@`HtH|$H|$AIEtnLHI9t[Il$HHH9t,LHH|$pH|$AHH9uIEM$$HI9uHHt @dAUL1ۅuA9]LH@IHЃ8uHHPHHH9ufH6H9tF 9rF$9sLH|$H|$AuL}1ɺM1H5yGfDH-`1ɺ_1LDHL011<HwHD[]A\A]A^A_DAዀHFH@ H@`HH|$LH|$AL61CH5{L;611H5RfAWAVIAUATAUH-vk%SHH8HFPH|$ HHt$DE1HD$IIcHH H#HHxLUH1IPH5m1L5#Lc Y^MIGHD$(kfI\$<@HD$L|$HH@PLH8uB;GL"IDLE1>LLI1Dt$ |$R[>Lb"IKff.fAWAVAUATUHSHHGPH83%uE1HD[]A\A]A^A_DHIE1E1j11HjjH tHL5=L#"LI1HEPHH8?X HHE1EctE1HAH@ uHEPHUH1H;HV%IHH;1H- HHHE1E1LAWH 8HjATAU H H;"HHHhXhL1ɺ1LfDLt1ɺG1H5跿LS1ɺ1LE1藿efL,1ɺJ1H5OoDL1ɺQH5$IAWLAVAUATIUSHH(HLD$I9t"H1fHI9u0%uE1H(D[]A\A]A^A_DHE1E11j1LjjH tLL5IE;L LI1rID$PHH8U IHjI$I9H@LH@(HD$'QIT$HI}IID$PLLD$H"LD$HI0I}LL H;HD$H1LAWLL$ LֹLYk袽MAL$LAt$SHL$0HT$8S H L@t:I}yI9yLQAM1ɺoLֿLL1ɺ1LE1I}hL1ɺ1LƼL]1ɺf1H5蠼L:1ɺi1H5]}gAWAVAUATIUHSHhdH%(HD$XHGPHH8S L1ɺHHHOH; IHfLH@I$H; LvHHHt$ jE11jE1ɿ jj/ H 1ɺIL1Ht_Dt$ EH裄H;HD$XdH+%(oHhD[]A\A]A^A_DI$L1ɺH51H;L1ɺH51E1{fDHL=7LIL1论IUH!LrHT$MH5{m LŅtBH1AVL Tm LLRMLuXZ'fDHT$LD$H;HrL3HI$HHT$HJHPHRHHtSH9HfH*HfH*^YE_,DhLA躂DL51@1ɺLLUL}1fHʃfHH H*XQfHփfHH H*XMSAUATUHSH y*%dH%(HD$HGPH8u(E1HD$dH+%(HD[]A\A]HHE1E1j11HjjYH tHEPHL-L{LLuH1(XZHHAąt$H$AHPH8HR@HwEfL1ɺ1Lӷ!9fAWAVAUATUSHHdH%(HD$1HGPHH87)%u3E1HD$dH+%(6HD[]A\A]A^A_f.HHE1E1j11Hjj!H tHL-3L{LI,1HH|AąL4$IFLx0LݻL`HCPLHHxHt)LLHAHEI> @HE1L1L4E1`fDL1ɺ01L;AUATUHSHdH%(HD$1HGPHH8'%u'E1HD$dH+%(HD[]A\A]fHHE1E1j11HjjH tHL-NJ2L#LI\1wHHAąt%H$AHPH8HRHOL1ɺ`1L#*艿fAWAVAUATUSHHdH%(HD$1HGPHH8&%u3E1HD$dH+%(>HD[]A\A]A^A_f.HHE1E1j11HjjqH tHL-1LLIs1GHHAąL4$IFLx8MtXL(L`HCPLHHxHt,LLHAHEI>\HELd1ɺ}1LE1訳fDL<1ɺw1L胳fATUHSHGPH8%%u41E1LH5-D[]A\DHIE1E1j11HjjH tHEPHH8QJ HHHEHEcH;Hu LQHHjE1E11j1jj& H HHHx`hL0HE`HH蛆AąAHb{H;D[]A\fHE1.L!IH51@1E1L1ɺH5}ıD[]A\@LT1ɺH5y1E1蔱]L$1ɺ1H5Gg(荲AąL1ɺ1H51ff.AWAVAUATIUHSHhdH%(HD$XHG`H-H2HEPHH88H Ld1ɺHHEHCH;HHX L4HHHt$ jE1E1j1ҿ jj$ H IHD$ LD$iyH;D$iHH9HHhHE`H2H,LjI1H5}į1HT$XdH+%(Hh[]A\A]A^A_HL=d9,LIL:1fIUH9HjHT$H'H5H踹AƅHT$LD$H;HrL.4H; HNf@I$HHHT$HPH@L@wf.L<1ɺ H5a1H;L1ɺ1H5V1H*LIPH- H1UL LLLwXZ_fD1ɺ!LLe轭Lv1Hr0HJ HzLBM $HHH9fHfH*HfH*^YR,AADpHMI9MfI*HWfH*^YwR,=DAAHuWEqLuI$1L1L5$胬LuAAHB(HtH9HmfH*H=fH*^YQD,EVADDD@HMAA@H1MIfII I*XHHfHH H*XLAfHL H*XcIIfIAM I*XdAAMAA?HȃfHH H*XHƒfHH H*X~A(Aff.fAWAVAUAATIԺUHSHhdH%(HD$XHGPHH8A L1ɺ(HH8H( HfH@HI$=H;HH LOHHHt$ jE11AUE1ɿ jj H 1ɺRIL]Ht[Dt$ EHrH; HD$XdH+%(8HhD[]A\A]A^A_ÐI$L1ɺKH5)1GH; L1ɺ-H51E1fDHL=%WLIL 1ިIUHLrHT$MH5L0ŅtBH]1AVL LL }LqXZ'fDHT$LD$H;HrL,7HI$HHD$HB@8t.HBLAHq|L5Z@Hp HxHtZ1HtSH9HNfH*HfH*^Y>M,ȅ9DΉJHPI $H@HHtOH9HfH*HxvfH*^YL,DiLAGp{f1ɺcLLLpHЃfHH H*XuHƃfHH H*XIHfHH H*XHfHH H*X-趰fDAWAVAUIATUHSHXdH%(HD$HHGPHH8r= HHH8IEcH;LH HHHt$jE1E1j1ҿ jj H IHDt$EunLnH;HD$HdH+%(HXD[]A\A]A^A_HaHEP5%L0E1DDHL=!L LI1ID$HHx LpLHLL$MH5L0LL$Mt*L1LLL$H5LL$AHLL$!HLPLL$1L=LemXZfDH 7HE1E1jH1HjLHD$(P|3 H 0L$H LIL1譣LlLA1ɺV1H5=E1聣@L1ɺR1H5E1TLH5 1)E1HHMLGPL1ɺ1H5Ϣ%f.1ɺE1LMH5R螢@ATIUHSHW`HGPH HHH89 HLHHHa t-LHHJ AtXH;D[]A\L1ɺH5L1ɺ1H5E1͡Ld1ɺH5詡1E1L71ɺH55|D[]A\@AWAVAUIATUHSHHHW`HGPDfH HH8H8 HIIEPL8LH1HtLL5CEL1HLAF AŅt4AFAEI>?DcHD[]A\A]A^A_f11L8H5_L11H5^@L1ɺ1H5E14tff.@AUATIUHSHW tAHD[]A\A]I<$H>IHtH tLpHH-eH^HL>SIH1膟It$XLZIT$AądL1ɺ1HJHDAVAUIATIUSHGPL0LH1HtLL [D]A\A]A^@11L(4H5OoL 11H5N@1E1L1ɺH5$[D]A\A]A^AWAVAUATUSHHD%%dH%(HD$81ELHHE1L-rL9L|$ M6I9txI~ tDD%M^H;EHLHT$ HLHT$I1L.RCM6Y^I9ufH1ELLXZHD$8dH+%(utHHD[]A\A]A^A_HE1E11jLLjjL\$(H L\$t1|$A=A%H:AWAVAUATUSH8D%%dH%(HD$(1EHLHE1L5I9t^IfHL9tHH{O tD %HsH}EuL1ɺ1LʛHL9ufH1E%LL蓛XZHD$(dH+%(uRH8D[]A\A]A^A_HE1E1Lj1jj>H [L$1A蚥f.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HT$dH+%(u4H1L7H5M蔚1ff.UHSH85 %dH%(HD$(HGPH8u\HvHHLSI1H5X1ZHT$(dH+%(uSH8[]fDHHE1E1j1HjjH A$Eu v %jHoeff.fATUSH@dH%(HD$8HG`@ H%HH/HCP %L H4,HE1E1jH1HjLHD$P( H tX$tqHYuH=H- AątnAHD$8dH+%(H@D[]A\LL1ɺH5E葘HAtHy@HL IH519H]`{# HfDH#HH#C`Zf.UHSHHH9t9HCHxHG`@u uHuHCHxuHH9u1H[]DHCHx#LK IH51LHCH@H[]ff.fAWAAVEAUIATUHSHH芞IHHHtbLHtHLrLLuKDLЙDLŚHL[]A\A]A^A_!1HmHHDL 1ɺ[1H5OLE1tfL1ɺU1H5DL1ɺX1H5DL1ɺO1H5ϕ%f.ATUSHH $H1dH%(H$1Hl8/HHXHL$1IHLuF1ҹHLdHtGLH$dH+%(ukHĠ[]A\HL5ufDƄ$fD1ҾHkHXHHJL$c@AVAUATIUSAHIHHILg'I}HH L1ɺHHt`A1LLHHt71H tYAuvH6[D]A\A]A^f.L1ɺ1E1H5̓[D]A\A]A^Ht A%AL41ɺ1H50E1ta1L1ɺH5G[D]A\A]A^ff.AWfAVIAUATAUSHH|$L$dH%(H$1)$D$\D$XDŽ$)$)$)$)$)$Ht BIՉ$"$ED$L$u#%#%D$IF`H.r H/2IIH9ǸHD(H H@@e ELHL XRL(PH5v1軑Y^D$H$dH+%( D$H[]A\A]A^A_@1L2H5\"%D$L1ɺ1H5)D$k@HH9AUt AFd ( EtL  IHtxAFduqA AEuL a HsH|$D1_D$L1ɺKH5dAED$HMIHD$(I9tQMtLIHtKHHH9t8Ht3H@@t)H|$1D ML9|$(B1EH|L4$HD$0IDML|$L-SHD$ HxVHEHD$ % %.AnL1ۅt#H@IHЃ8PA9^LwIHt7HT$ DLu#1ɺLLD$HIHt7HT$ DLu#1ɺLLiD$HIHt1DLpIFHP€AF1 H@ H@pHEiInpHD$\D$X=!IHH HHA11LHH1HJHD\$\ED$XH<$r 1ɺLIL1袍fM6L;t$( L4$DL$HED%EL EHL ( LDH1ɺPLH51-^_D$mfDL HaL DHp1DL1ɺxLLlČD$HoL*12H5&茌 HL$\HT$XLHT$8HHL$ЅZT$\udL$XtdH<$1ɺLIL1#~fD1ɺLLD$HXD$XIFHP Hzx5=%HHUHh0H<$HD^1ɺLSIL1U茋IFD%AXAYH@ H@xEH1LЅ%uH$@fL|$@11Dd$LLd$8fIFHt$LLD$\H@ PpD$\(H<$H1ɺt$ILC1L贊A_X%u%% wA? %uU%'D t4L1ɺ1LL|$@Dd$L=D$HL12H5InD\$HL|$@Dd$LE(DT$XED$D$H @H谕HD$0Ht6H螎IHXHnHHt$0HHuHD$0H踎HD$Xq\$\bD$X^HD$0H{8rD%H,$HHHHE1ɺLSILt$81Lj5%ZYIFH@tIVpHt$01A L1sHD$XHD$8HD$\HD$1ɺLLL|$@Dd$LKD$HL1ɺm1H5L4$ML1ɺL%1LIG@@IH1ɺPL NLL{@AUIFPD=F$H8E>HE1E11j1Ljj^H IIL8H9D$HH-L4$MMELd$Hp1DL4I9SLM6ML1ɺL%1LֆHIFPH8l$HL$`HE1E1jLjj肸H \$hL!HLSI8D$\%IFPH#LHHxgzIq1ED$HbAEPLL?IH5}1…D$MLN1ɺIpHH H$H߅$(1ɺLLID$HML1ɺ#L1ɺ&H5QI~H1ɺPL L1ɺ[HLg迄D$HEL4$M_ML4$IGHP HtHHtwLHL'H1ɺSILL L1ɺg1H58D$HML;|$(NfHX(H<$1ɺLIL1D$#?ff.@AUHATUSHL'I9AD$L1)fDI$HtH؃8tkA9l$LH@I$HH؃8uHx£AŅu1L1ɺ H5HD[]A\A]@HxAŅu1L1ɺ H5ׂHD[]A\A]fHA[D]A\A]ff.UHH dH%(HD$1HD$"HD$H9t HuPHt$HtHD$HT$dH+%(u-H ]HL$H1Hj1wATUHHdH%(HD$1HGPH$L .aHLSXtGHH1HAątdAHD$dH+%(HD]A\HAL1j IH51F@HH<$L HHtIHp 1ULH5XZOXAWAVAUATIUHHSHdH%(H$1jID$`@u uLHH[L_D= $fIID$`)D$`)D$pHH,)D$PH+D$pT$lEKHHHLHJfÀ`Me`A'IIAIH9u?HH9dHPHzyLA8 LPIH%HD$H1bHt$1L1ɺ C1[LHHLHH L4SI1H5~X1ZH$dH+%(HĘ[]A\A]A^A_I IEPH HILD$ Ld$ LLޫDt$ Ey1LHLR\$ rIEPHL( LInHHD$LHt$1LI 1}HL$ HE1E1j1LHjjvH L$ tD$$u T$81LLd$P H5H LLH=!SLLHu"Ht$L11n |L6!f = %f1LH5M1|IEPHxMe`AIIffMe`rHIU`HH!H9MH"H!EVLEt|E1+IHtH|"u0AE;fLsLDH@IHH|GattLF> LIDD %ELAEeaLl$xL$ht$p|$lHL=eDD$PL5dL%rHcLDLLDLDEHDAWL^AVIS ATH|SHHD$01zD f$H EHt$L@11Z z#DL(L1ɺIHHD$H1LzL@H@HD$L4$L9*IMHD$fHD$I^I9IfM?M9IwHXuLk1ɺ1H5yLV! LMIMe`LD$hLl$xDM6L9t$:IEPL L H$HXM9t+MfDM6M9tIvH脃uH$HH$H9D$uLHt$1LyI1xH9HhAuIHBc2 HLHD$H1UxLL1ɺD IH5߹1$x6Ht$L1ɺj wH=\MH1HHtLHL$hvL1H5wL LYHI#E`IU`L$4H"r0H!r)H%r@u|$huHH H9LHt$LIb 1vLv1ɺH5 v!ATIH5`UHHHdH%(HD$81S LUfHLHHH$HD$(D$D$VHT$8dH+%(uHH]A\螀ff.ATIH5кUHHHdH%(HD$81 LKUfHLHHD$HH$HD$(D$%VHT$8dH+%(uHH]A\ATAUHHHHdH%(HD$81T$fH$HD$(D$D$tHHHQAH=KHD$8dH+%(u HHD]A\nff.ATAUHHHHdH%(HD$81$TfHD$(HD$HH$K$D$tHH'QAH=QxJHD$8dH+%(u HHD]A\~AV11L'AUL-L5%ATUHSHLt=|%uK PIHHH51IqHQvHD`DH=S%DHN HHHtCL`Mt:IT$TID$\H3$H3D$H u"IT$dID$lH3T$H3D$H CDE16Ht%tQ1HIHtπIL 11ZH5E1kpfDHhuHD`DH=j%DHeHHYL`MLA${IP1LOH5)oLzff.AVfAUATUH8dH%(HD$(1D$ )$)D$HooVHIH) $)T$tHD`DH=%DHHHtKH@HtBL`HMtID$8H$LT$  HC8T$@T$   ‰T$Dtu HDŽ$H$Ht\ HDŽ$HDŽ$LuMLLHD$PH$H$tHD$HteI$H% L9 HpH|$g$HHH9HpH|$g$fƄ$H$H$)$L)$Ao)$AoU)$I9II0MA0L9fDHQH7HGH32H3BH HwHGH3rH3BH LjPHJXAHMtJH\$0HHl$8DILHfTIHL9uH\$0Hl$8$HD$8HD$0$H|$HLH|$HHAH|$XLD$`H|$XHމD$dݙ|$D$h*|$ D$ls*t$@|$D$pt$D|$ D$tѩH D$xHD$HHEHHL$HyH9pHPI$HOL9FHHHHELLt$|$TL1W|$8WR|$hdW|$HWQ@ZHD$xH@H=HHEHHH9HpHD$0H HHEI$HL9HPMHLLDHHEWVLL1Q@RjAU)ZHH$H0HH9HPI$H$HL9HpHHELQ@RLp1WVLt$xY$H0HHןHDHH`H9WHxDl$dH HEHDI $HL9HqHMRL;vWPL1@VLYH D\$pH@HEHDHHH9HxDT$lH HEHDI $HbL9YHqHMRL&{WPL1@VLvXH DL$xHHEHDHHH9HxDD$tH hHhEHDI $HL9HqHMRL7WPL1@VLW$H HHHDHH1H9(HxH EHHDI $HL9HqHMRLWPL1@VLFWH|$PH 8\H|$8.\L$|r$Ht]I$HmH;l$H$Ll$HHxH@hI9g MtI$Ht L9=H u$HtHHt H9HX$Q@LPLL$81LSqVH$ZYHt$HPHHI9H9uMtI$Ht L9H$HPLL$8LL1VHt$H$A\A^UDH L9IT$ID$H3UH3EH 8A[]DA\A]A^L A$AT%1LɯS@H5Z>XZfDM1LZH5l)>[D]A\A]A^DL CLLPff.fAWHBAVAUATIUHSHH(L*HD$MpL=LLALsPMtHHCHSH9ufHH9t(@ tI~HHL@LK`L}@MtI~HLLL$GLL$tuHL$LMLH3tAąuTMB1LH5(<H(D[]A\A]A^A_LK`L}@LsPwLsPHT$LHAąYEPu H}XU`+ut&9s ƃvƃLcPMA$HuX}T9^HKhA$AƄ$A$I$HLMI9MHHL@VWPAURL=؀1L;HE@H0LuHL]8LU0HD$HCPHPPD1҃t~HpHHChAHH <HDHXHHLH9CLIL\$1L @LT$RVL:AYHCPAZLT$L\$DPPMLMt'LLLD$L\$3EL\$LD$LL\$?HSPH|$HT$QDHT$L\$HHHChHJHHFHH:H91LJASL|1Q@L:_AXMHCPLMtLLLD$nDLD$t}L>HSPLHT$CHT$HHHChHJHHHHzH9qLJAVLL!1Q@j9Y^H|$HHCPLMt LCtwL6>H|$LsPBIHHChINHHHHH9LJt$ 1LQLЬ@8XZMD$0HhMD$0HMMD$8HHH9tFDHqHHpHI|$0It$8LHqIL$8HHHIT$8HH9uAo@LvPM1L.H5b}8HC`Lh8Ll$MDI$E$H9uA9tHKhHtL Mt I9H $PM1APL^VH5|WRQ17H0AƄ$E1MdfD]TEfDD=q$EDMK1LڨH5\|7/@HKhA$A$I$HLMI9MHHL@VWPAUR fAƄ$HKhHtnLMtfI9taMHHL@AVH5{WP1AURY6H0kIIzL $b@L $L ٧$@L ɧ$@L $@L $#@L $?ML=L5MLVL15LL$LLAg5MLsLF5@AULoATIUSHHoHt=H]L9t4fH}:HUHEHHHBH9HI9uIl$@Ml$Ml$Ml$@Ht7H]L9t.H}9HUHEHHHBH9HI9uMl$HMl$@H[]A\A]HxHtVxdu?H0$H )$Lz{H9u HH9t@H;BuLE{LHHdL{HLfL!{HLÐff.ff.HI11L*H5d3Hf.G878'8AWAVAUATUHSHL/HGMHF8IH$Lt$I9t#L~(HI~(LU=Aąt>M6L;4$uH|$tyH$AHEIHEIH(I;Hs1MLH5%b2XHE HZPhHD[]A\A]A^A_ff.@AUATUHSHHH(7H;L`LIHtLHH@IL-1ɺN1LL1H;H@H*AątHA[D]A\A]IL1LQu1HD[]A\A]AWf1AVAUATL%)ULH1SHHxdH%(HD$h1Ll$0)L$@Ht$HLHD$ HD$)L$0)L$P裌HLHT$ H芚AąL}Ld$ IPLHLpME11L1H%AąL%f11LL)T$@)T$0H\$H)T$P HPLHT$HAąHULd$HzPLHT$HT$HMLxM@HpH5HZAąLuXHEHLLhHh`AąL1fLLxLHDžxL=HLLHDžH)XH1)D$@)D$0H\$H)D$PHt LLHIAąL%Rf11LL)D$@)D$0H\$H)D$P詊Ht LLHAąL% f11LL)D$@)D$0H\$H)D$PVHt$LHH蟗AąbL%f11LL)D$@)D$0H\$H)D$PHt$LHHHAąAL%f11LL)D$@)D$0H\$H)D$P訉Ht$LHHAą L%f11LL)D$@)D$0H\$H)D$PQHt$LHHAą L%>f11LL)D$@)D$0H\$H)D$PHt$LHH裕Aą@L%f11LL)D$@)D$0H\$H)D$P裈Ht$LHHLAąL%4f11LL)D$@)D$0H\$H)D$PLHt$LHHAąL%Uf11LL)D$@)D$0H\$H)D$PHt$LHH螔Aą{L%f11LL)D$@)D$0H\$H)D$P螇Ht$LHHGAąL5Gf1LL1)D$@AH\$H)D$0)D$PAHLLH*HT$(H5HhLl$0LY0L`HELH@PHx!HHtLLH+9HHLl$(L0L`HELH@PHx܍HHtLLH8HHAJ@HEL qHPHHCHtLHLJR5H5r1|*^_HD$hdH+%(HxD[]A\A]A^A_@HEL qHPHHCHtLHLR2H51E1 *AXAYHEL =qHPHHCHtLHL"R>DLdk1ɺ;1H5)(fHSIOHHpHtHQMLnP8OfDHEL pHPHHCHtLHLRAfLj1ɺO1H5)f.HEL =pHPHHCHtLHLRH;f.HJHHSHoHtHQMLfPDoHEL oHPHHCHtLHLRUHEL oHPHHCHtLHLR[HEL _oHPHHCHtLHLdRa]HEL )oHPHHCHtLHL.Rg'HEL nHPHHCHtLHLRmHEL nHPHHCHtLHLRsHEL nHPHHCHtLHLRyHEL QnHPHHCHtLHLVROHEL nHPHHCHtLHL RHEL mHPHHCHtLHLRHEL mHPHHCHtLHLR1H5"E1+&XZHEL amHPHHCHtLHLfR_H{腡LFIHEQpH40@ATUHH5fSHhHHHPH1"fHH5HH@HPH1~"Aą pH5H1\"Aą1" @: +HHH H5XH1!AąAHH5SH1!AąLf1ɺ1H5Q]$$Le1ɺ1H5+7$D[]A\ALe11ɺH5$D[]A\@HH5H1 Aą5fH5 H1 AąL2e1ɺ1H5iu#9HH5H1h Aą/H5H19 AąfH5XH1 AąfH5@H1AąfA[]DA\fHxH5vH1AąM?HH5\H1hAąMHH5AH18AąMLc1ɺ1H5!f.H5MH1AąfH50H1AąL*c1ɺ1H5am!1Lb1ɺ1H53?!f.Lb1ɺ1H5!f.Lb1ɺ1H5 f.Llb1ɺ1H5 sf.LAVAUATUSHXH$LD$(Ht$0HD$8dH%(HD$HI@L\@HD$(HhD%h$EuHD$(G$HD$(D$L|$@L5û$LhI$I$HD$ H9#fDuL1ۅuf;]LH@HHЃ8uH@LLLhID$PHIU@H_D\$@IE@EH5HH)H9 LjLqH1ɺtAUI1LH5D$AYAZ;]LADHmH;l$  $#T$$ LAL1ɺIH5z1IE@HtgHHt_H9tZLjL融H1AUI1L:wH5D$,_AXgL-i$@L-Y$HD$(HH@L1ɺNH5SLHH1YǃE1HD$(H|$0HHHhH4HH'HD$(H|$0HBHhH`4IHHD$(H|$8 H$Dp衘HHHD$8DDA>H8HwHH|$8}LQ1ɺH5YX$LP1ɺa1H5+71&LC1H51HT$HdH+%(BHX[]A\A]A^A_Ë#HH@L1ɺHH5LHH1ǃL~HHHM1LYH5]W$LL~IH51#LO1ɺTLO1ɺ1H5$H葊LIH5U1 LVO1ɺW]HD$8;H8HwHuPH|$8{LO1ɺH5]\$HL IH5ö1( LN1ɺZH|HEPHHoIٹ1LH5۵~$xHL$(oxo)$o(o8oHHHXLMLH>LSL`HD$8LHH8oHHtLLH&HHD$(HHLLL`HD$8LHH8nHHtLLHHHP"fAWf1AVAULATL%ULHSHHxdH%(HD$h1Lt$01)D$@AEHt$HLAE AE0HD$(HD$ HD$HD$)D$0)D$PfHLHT$(HtAąHULd$(HzPLHT$趨HT$HLxM E11L1HAąHH51HsAą]HT$H5X%HtAą^Ld$LaHLLHH5׳HrAąVHH5 HprAą}HT$H5HsAąVLl$LL`HELH@PHxlHhLLL%`Hf1LHL1)D$@)D$0H\$H)D$PeIHtPLHT$ HrAąCHULd$ HzPLHT$HT$H'LhML%"|f11LL)D$@)D$0H\$H)D$PdHtLH H8qAąL%f11LL)D$@)D$0H\$H)D$P?dHt$LHHpAąL%=f11LL)D$@)D$0H\$H)D$PcHt$LHHpAąL%f11LL)D$@)D$0H\$H)D$PcHt$LHH:pAąL%f11LL)D$@)D$0H\$H)D$P:cHt$LHHoAąL%f11LL)D$@)D$0H\$H)D$PbHt$LHHoAąL%f11LL)D$@)D$0H\$H)D$PbHt$LH H5oAąQ L%԰f11LL)D$@)D$0H\$H)D$P5bHt$LHH~oAą"@L%zf11LL)D$@)D$0H\$H)D$PaH\HEL}XLHH`MtIM`HLAąAIHEL MHPHHCHtLHLjR:1H5XZHD$hdH+%(HxD[]A\A]A^A_@HEL LHPHHCHtLHLR7H51E1)AYAZHEL ]LHPHHCHtLHLRE;f.L|F1ɺ@1H5 f.HJHHSHKHtHQMLιP=?fDHEL KHPHHCHtLHLRYfHEL }KHPHHCHtLHL:RMf.HEL =KHPHHCHtLHLRJf.HEL JHPHHCHtLHLRTf.HEL JHPHHCHtLHLJR^f.HEL }JHDžHPHHCHtLHLGRaHEL 11ɺH5>D]A\A]H}'yHL׵ATIE11H5GXDZ]A\A]@1L=1ɺH5ɡD]A\A]fDL=1ɺ#1H5!fL|=1ɺ1H5qf.AUATUSH8dH%(HD$(HHxHHHH5HHPH1pAątqHH5HH@HPH1IAątr`H@fAHD$(dH+%(H8D[]A\A]L<1ɺ1H5yDL\<1ɺ1H5QDL4<1ɺ1H5)E1tbH5H1gAą(L;1ɺ 1H5ݟ+fDHH5}H1AąHHAąHH5wH1Aą%H H5iH1AąH(H55H1AąH0H5'H1wAąH8Ht:I(L i AąLH5H11AąH@HI(Lh AąsLH5H1AąLh:1ɺ61H5]fDL<:1ɺ(1H51mf.L :1ɺ#1H5O=f.L91ɺ&1H5ѝ f.L91ɺ)1H5L91ɺ*1H5{L`91ɺ+1H5UL:91ɺ/1H5/}kL91ɺ51H5 WEL81ɺ01H51USHHGH@ -HBf4HHGHsTH-H@PHDL$Hxj]ZL{YI1ɺ?H1DHEtL_1ɺC1H`LLPMtLH1ɺI1H)HXHtHxHtE11Hx1!PHHLZ1[O1]fDH@H[]D@HHH9HF1ɺFHILz1pff.AWf1AVAUATL%@ULHSHHHdH%(HD$8HGI1H@PLp)D$Ht$L)$)D$ PHtLHUTH^]AąL%@f11LL)D$)$H\$)D$ fPHf11LL)D$)$H\$)D$ 7PHt7H@ Ht.8MLf11-H5lKf$HEL ;HPHHCHtLHLURDL%U?f11LL)D$)$H\$)D$ OHf11LL)D$)$H\$)D$ dOHt3H@ Ht*8taML11-H5|e$HEL :HPHHCHtLHLRfDLxA?tL>LL`LVHLLHHPfL11HQ>)D$)$H\$)D$ NHH}HP}Hx tNHEL 9HPHHFHtLHLR1H5$E1oXZ#1L\HXHAHD$8dH+%(uHHD[]A\A]A^A_fHEL ]9HPHHCHtLHLRxH51Y^Hp>xHL7CAąHEL 8HPHHCHtLHLRf1ɺE1L2H5NfHEL }8HPHHFHtLHLBRf.HEL =8HDžPHPHHCHtLHLR:*f.AWf1AVAUATI1UHSHWHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0LHf11HL)D$ )D$Hl$()D$0KHt7H@ Ht.8IL11-H5 a$ID$L %7HPHHEHtLHL«R7DID$L 6HPHHEHtLHLIRH51E1hY^HD$HdH+%(HXD[]A\A]A^A_HXM|$;EIPHfH%LpML=11LL)D$ )D$)D$0Hl$(JfH11LL)D$ )D$Hl$()D$0^JHt;H@ Ht28L 1ɺ-1LH5n`$ID$L 5HPHHEHtLHL'RID$L l5HPHHEHtLHLR{fHUIOHH)5HtHQILP@fDHXIT$;8HzPHHT$uHT$HwLxMjH8f11HL)D$ )D$Hl$()D$0HHtGI$HHHUE$HAAAuID$Hh`;fDHLAŅLL/vAŅLLtAŅID$AHH99L,fID$HUHHHH3HtHQLE1P1H5KXZ@L-1ɺ1H5ёf.HJHHUHI3HtHQILP`fDLt-1ɺ1H5iLfLL-1ɺ1H5A$DAWf1AVAUATL%ULH1SHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0FHf11LL)D$ )D$H\$()D$0FHt7H@ Ht.8MLԤ11-H5ڕ\$HEL 1HPHHCHtLHLR7fDHEL 1HPHHCHtLHL2RH51<A\E1A]HD$HdH+%(HXD[]A\A]A^A_L`L}A<$"HmHt9}tL1L }L<HmHu *$($HH-AL5щ $tt#f.H8L9CtuU1ɺLS1L LVX^$ $뱐D$ T$L1H5w}$R[P1A[[`f.HHL^u C 0$H8I9ufC;D$ LK HLLL$ LL$HHCLPL9q1fD sAYEAZD 5$HL1LSL ڲ1v_AXLL\1ɺVH5NR@L- &O$Hօtf.1ff.fAWAVAUATUSH(H$`HD$dH%(H$IHtIIPMB uQ1LkSH51H$dH+%( H([]A\A]A^A_fIPH1IH-DL=LJHpHW1HzI$A$`A^YHHHD$H9ӺHD@fIMEu#ALBH HHD$AHtl=D M$EHt$|L@I|$D$|HHL$mXLHI1I$1LHpD6 HD$HI$M$ @f|I$0I$I$(MHH9 IT$fH L)$H$)$)$)$HDŽ$HDŽ$HRP)$)$ooI$8)$H)$HDo)$oZI$@)$H)$HD)$o")$ojH)$HD$(HH$HLHD$@H1ɺHL1 @MuI$0TI|$rVLSHI11I|$T$2VHHT$ I1L1RfVAZA[;DL1ɺx1H+1I@I|$Ht$HL$HT$UHT$LΝI1RHt$ VHAWHL$(QH 1DI|$T$bUHLT$IR1H_1AX@H1L'3 HD$(HH1LHp3 HD$@HeE$`EmIXHPHD$8H|$ HHHuHHfHT$`HD$8H@HHKH?#H\$PILd$HIHLl$XHLHDHD$0HL$hIM'ILd$0Lf.I4$IHHuMMuLd$HDI$ENTM$0M$(HD$0M$ HL$ HvHHEHD$ H|$HD$HHHKLL$L 18H5H$L21ɺIAH$SHLlSI{fDLl$XHt$81H\$PLd$HL@HD$8HAL|$0LhH\$0Ld$HLt$ Lt$hMI]MLMu;I4$IH'HGuMmDI$ENTHD$8M$0M$(HD$0H[HM$ HD$ H|$ H5=HDL$HDL$HHHED$HD$A?A HDh LŚH5 ~1G$ZYdf.1ɺHL}1fDLL$L1'H5}F$H>j@LhH$hH|$1DL$HD]DL$HHH HD$H8HD$@8Ld$@DL$HLCDL$HHHHHMN1LH5|E$PL=_H|$ LL|$`A1ɺHLG11ɺHL%}1HwHHH|$DL$@\ADL$@CL1ɺSH50|/E$Ld$HLt$ H\$0I$A$`ENTM$0HD$0M$(M$ HPHD$ 1ɺHL^1IE H1ɺSLHp1SL$vHD$XH HHH6L9bH fL9HH@HuI3L1ɺJ1H5{D$vHD$H8HD$(8tQLd$(DL$@LhADL$@HH@Hu6ML1WH5zC$HwH@H|$DL$@?DL$@u2L"1ɺ\H5gzfC$IEHBHD$H8HD$8twHt$DL$@@DL$@HHCPHu_LL$(`1LH5zB$_MmHD$8LhL1ɺ;HwHsPH|$DL$>DL$-HD$0H|$8L(L0H HD$L8HCxHD$ DxHǃ|HD$Ht$81DL$HH8:DL$HHL`MtWL5{EIE|ID$ Md$Mt+Ml$ I<$Mt>AEu6LStEAD9|sD|ILÕ1xH5xA$L1ɺeH5[xZA$L1ɺsH56x5A$HAHD$ 0ff.@AWAVAUIATUSHHHBLx ME1HH-C6AMMtLA?u]MwHL~HLktH51LXuTMAMuHD[]A\A]A^A_DMLn11H5t<kH5yLu AH@H5yLuA(@E1qH)1MAVL!1ɿH5ysXZME1LpH5Os fH8HtfHFHt;tHvHu@HfHHtH֜fDHfDAUATIUH SHH8Ht`H1 fHHPHt :HPHHuDHHAHt 8HAHHuI$ H9tHCHt Hx.HH9uI$0I$(I$ I$8HHzHRHE1 fHHqHt >+HqIHu1HHJHt 9HJHHuH H L+HH9DHS HtHz..I$0H HSHHC HHQH HrHH3HSHH*HH IMLLI9tsIA$qH90dI$0f.HJH[HNI$8HBH H L+HH9ufDI$8H1HHPHt:t?HPHHuHd1[L]A\H52pA]mDHPH+HQI$8HxH@,I$8uH[]A\A]HPHHVI$8HxH@v,QHQMtIPLM$8HAI$8HAHDHHAHtHBI$ I$8HAH9u,@HH9t H9HuH0HPHVH2HH9u@Hy+f.HH HI$8GH om$H5FH=WAWAVAUATIUHպ@SHHH|$L$HLD$LL $dH%(H$1i8 !HIHH%IEHHIEHIEIEIE IE(IE IE0IE8IE0H$IE@$H=5Y$LHPwAƅLL1GAƅI}HLLg 11ZH5 DHsPHL|$@]Ao$LAoL$D$`)D$@)L$PL|$ vLDhDtH=X$DLsvHHGLxM:MoHHL3MWH$IIG@L{PIGLHCIGHHChI_HtHHt H9L 8$AT1LxrU@H5 AXZH$dH+%( HD[]A\A]A^A_fDL- L1ɺ=L>fLJfI}HLL11TH51 WfAUL- M1ULfL1A[1A_HhSIHHPTH@\I3$I3D$H uIWdIGlI3T$I3D$H XHChHHHzH9qLJULLAVi1E1AYLAZ1ɺjL1gfL-" HLnI1AV@tL_AXIHHjIGHHJIG MWHIG(IG IG0MWMWIG8IG0HU$LT$0HD$`HP։T$(qT$(H|$H\sLT$0HH[LXML\$(IL1IL@LT$L\$(LT$ISTIC\MCTI3D$I3$H uIPI@I3T$I3D$H RHt$H|$LT$(L\$0LD$8褞L\$0H|$D$IL\$腞T$L\$LT$(tF AƇAƃH5$HH 5$IIOL=4$LxH=4$H4$AIEH4$IEL(L-4$5HLT$H|$LHPprLT$AbIL^L1mIHdL\HILAPL#1AsHE1ATIHH L r@Ht$ H|$8@LT$1 LT$L\$=LT$I1ɺAƇL1AƃL͊t$ AVR$YL^1ɺL1qLT$9*"HLT$SH=dR$HPqH9H=JR$LHPpLT$AILL1J@L 2$ILDH51E1 1ɺLL%}L\$LT$qrLWIIL5L;I|LL1E1ILЇwff.AUATUSHHt>Hu=L։1ɺD1H5|eL%j$譿HL[]A\A]HHH;LhLn"IHBL1HH]HH0HHH^t LE1%@ALOAH Ht=H0LLBNuԀ.tπ_tʍqՁt HIufAA<$tU H5jL1ɺUE1LۈH5:dwfMAIL11PH5dE19@L1ɺI1H5c]f.AWAVAUATUSH8H<$Ht$dH%(HD$(1HD$ HK>BH|$H5dqHHPE1Ll$H\$ H LH荾HL|$ E7EtH@EwIEtIDA uA#tMtA<$u4ALuBHt<#uH<$LIiLL$L11xH5bӼH|$ H!u"HD$(dH+%(u[H8L[]A\A]A^A_L71ɺ1H5BbzL1ɺe1H5bE1TE18>1ɿH5aRLhhPLL$1Y^Rff.@AW1ҾlAVAUATUSHHXdH%(HD$H1od9H=g5H\1ҾpH轚H^$L$ST1ҾjH߉L$舚1ҾqH߉Pg-$1ҾH߉V^$Ոs1H߉E^$PHHHt1ҹH=#-$.H1f1ҾHD L$\EuK1ҾoH߉-K$N1ҾmHA謑HHD$HD$HD]$EEH=fD$A]$HD$EIHt:ڿH01HH!ILDNuHD$HD$EH5rHHDHH\$H\$1ҾtHUvH߉l$B3HLx 1L%J_MtwL-VfDMMt\A?"MwLL# H5L tH5L MMuDL1A1LLLwHH7#l$xHH/ l$nH߉k$=2HHh E1Ht\L50ML1Lm1XHmHt#}uH}@HmA HuD1H\$ D-wk$H|$HHD$11ILodLD$8۷H:H9*$H=(k$HtfHk$H=,k$*k$Ht&萼H k$Hj$Hj$j$HD$HdH+%(HX[]A\A]A^A_fL1ɺ<1L#fDH5LٹuEDHut1ML8~1LѶXZrf.H5%L聹tMH5Ln fDDY$EY$f($O@&fD1ҾkH@H!8H9 ($=H}HF($HH'$H5aL衸~H5L芸@̀4f fDkX$@Li1ɺG1H5aWfH=2ڷDX$HD$H|$HHD$$HL5NX$M1t$ DL$$LHH$aY^_JH=aAL:H5EmIH1HW$H5ҡLt/MLh11+H56NfHW$HW$P@MLv11H5M L !1LE1LzgLf1ɺH5MƳH5L肶tH5Lou[L.1ɺ"1H54MdH=_V$ѼIHEH5Lu ML1LY16L%XLLӲy8¹}IHlIH:LQH #HDAP4L^QH5NLP1xH ڼf.AW1ҾAVAUATUHSHOH1ɺHHHH1ҾHHL-L5 1҈nH 1҈EH 1҈1ҾHlw1ҾHHGaL~HIIDŽu-DöHDX@II%%uAw@EtU@O+IaLH@8tHuL-V1ɺ1LTL褰yfAwcILDIٹL}4H5+VcH1[]A\A]A^A_fL}!L-U1L)ML1L})1HDžGH[]A\A]A^A_f.LGH[]A\A]A^A_DAwdIHkfDU1ҾHSH'}uHH[]%D1ҾH}HuVtH-UL[1H#H11LH1[]DHktHZtNAWE1 H "AVAUIATIUSHdH%(H$1Hl$@HAMMHMLt$fDMM+If1HL1)D$ )D$HD$()D$0 HHtHhHA$PL=( HmHH} uH]1;@HHHD$ $H]HD$Ls MtvL+LLuMAuAI$I~tGMvMuD$fDH5YL蹷 H[HtD$Ht$Lz$L1ɺH5R_D$fDMi1H-pRLzH螬L:1ɺ1H聬H$dH+%($H[]A\A]A^A_ú"LLiuCHkH'$맹tH-QLXH_I$Ly$tAADŽ$PIٹ1LyH5yQ豫$%LA1ɺH5IQ膫ff.AULRATUHSHH>uHGLHEL-^$1IHhHWLH} IHLID$HHH H >I$H(ID$H(L L(;H8AHD[]A\A]1E1LzxH5PQHD[]A\A]1L1ɺH5OE1HD[]A\A]fDH0AątQHA[D]A\A]D1LxH5O輩HD[]A\A]fDLD1ɺ1H5OO臩Zff.fATUHHhu)1H8HtYAHD]A\1H5 Aąu1L1ɺH5NHD]A\1E1LUH5Nff.@AUL@ATUSHH@I9t_Hf.HL9tHHs1HAąu1L1ɺH5 NBHD[]A\A]@HA[D]A\A]ff.AT1ҾUHS HH0IHta1LHIMt []A\DƃLv1H5UM荧[1]A\fDH}8b HHHxHHHǀ0H1H)8HHH0HHH H(H !f1L1ɺH5Lߦ1HDž0LSff.@AUATUHSHH>ty1IHtjH L I9u BHL9t:HSLHdfu1ɺE1LH5KHL[]A\A]ILR1H5KDAULoxATUSHLgxM9t]H/H{H脨t3I|$0Ht HntM$$M9t)I\$(HHQuHL[]A\A]HE1[L]A\A]AVAULoxATUSH_xI9tgHL5  HL9tPHS8IM1HH)Aąu1L1ɺyH5J[D]A\A]A^DA[]DA\A]A^ff.AWfIAVAUATUHSHdH%(HD$x1Hv H|$ H\$HHD$HH HD$PH$XHD$XH HD$`H̜HD$hH HD$pD$(BIH@8IHH(HPIHIHCHt>LHuE1HD$xdH+%(HĈD[]A\A]A^A_LL%!v I$L|$MHHD$L5PH#$D,$HHD$O@AG 1LMLnPAD$1H|$ LoBIL9}HIHHX Lx(IGHHIT$H$ pEgH|$uHTH$H T$ID$0IT$<@H|$L|$H#L%OHl$ ^HoIHHCI](LIE C IEI` AIE0t HtIMLHnMM(1L$O1ɺ7LHΡH/#H9`HD$ŬHHmHNHC@@HHHC(H#HC PnLK(L%G11LN!L@HQHHVHHC HHHC(Hu#HC mLK(L'N1L/1ӠHod$ګIHH迫IHHLHIE(H IEH#IE DmHMLID$(HID$H#ID$ h ID$0Ht IL$LHlgHAt$(MM(1ɺ~L[MH5AM1ԟHB$۪HXZH.HEHHHC(HHCHw#HC ^lLK(LL11H5EEQHbHHH1HHHC(H HCH#HC kLK(L2L11[H5FڞALd1L$語H|$蠣D$$L011 H5%DsD$LbL11mH5KAL1ɺ1H5C E1G$L1L.1D$L1L$5ѝD$$La11H5C褝D$L71ɺ|H5J|6$L11ZH5;ESD$yH A$H5H=۟MLkL1nb1LlH5BJܜLԡLkL1%豜E1Q1L#lH5jD臜E1z1LkH5LB]E1ILjL!14E1[1LjH5A E11fAUATUHSHdH%(H$1H! Ll$AALɠH}HXHH`HT$AHxLHHILHLHH) H)HHL$L_H}HXH/Hn%t$HA_tT$AuATfTcfkE18象HL 3HPH:HLFPH4H5<@P1qH H$dH+%(HĘD[]A\A]DL1j1HDžH5?H$HxLHHILHLHH) H)HLi1HDžH5a?虙'@T$AۉATTf.$ۉATTJATfT8谣AUATUhH1Ҿ{f1Ҿ~Hp&x1Ҿ}HAx1Ҿ|HAoL~1ɺHHDpDDHSAą1ҾyH9fz1HtoHHtH*AąAD]A\A]Lih1ɺ1L%H5=(LH1ۃLHE1A11裂D]A\A]f.1LE1ɺH5=ϗD]A\A]fDL\1ɺ 1E1H5_=蜗D]A\A]LEE1ɺ1H57=of.N:$SHuNH=0E H EH߾HHD1H#:$d[:$f.H59$=9$"9$fAVAUATUHSH(HtHx輛H(fH@H0HtHx葛H0fH@=$tu$1HbH="9$tH~HLHI9t"DHGHCHHG PhHHI9uH}xLexHI9t HGHCHHGPpHHI9uHHtHPHDžBHHt衚HDžH@H@HH9tHRHPHHHH9uH81Hu+f.HHPHt :CHPHHuH@HtCHG11eu 蛞8 tF11H~4t,H=#H5tHHDžGfD1u 58 t1ߜ~@HGWH/H}HtH}HtHGHtHD 7$ED%$Ej=T%$,6$P6$H=6G$HtBH!G$6$ 6$H=G$6$G$Ht&xHF$HF$HF$F$[]A\A]A^@D $$Et#Lc> H5c$ _H=u5$Ht軟H=5$HY5$HtߗL5h5$H-$H5$LH9mL%@Lc1^L$H$L-@H9t:fHIs LMe1I$HY^H9uL'L1L>ci$$4$(DHPHHQH8HxH@Of.{ fD苖 fDfDLa1 H5%lmH5A4$=34$<4$5HIL H#H5 mHu&HDžG1H@#H8CH;ۜsfDAW1ҾAVAUATUHSHdH%(H$19^E1HD%2$ HHX L->Hu6u@IL>1L%18H[HD;:HkEtrH!Ht0|/)HuHH= >H9HFPt5ILa11H55E1赏Hk2$Ht$HڔADžD$(%=@#H胔H=<1$HPH$HHT$GIHHT$1H茐H$I~HH8H=h1$H[1$H[IHU1$IFHJ1$L0L5@1$HA@Hfk8贕H1PI1L<L菎XZPL<1+H5<\LK1LZ`H534H$dH+%(HĸD[]A\A]A^A_Ah_]1E1Lb_H53L_E1{H5[3蓍ZH 1$H5H=ڗf.AW1L;hAV1AUATL%2ULHSH' 1$As$#=#tu贰1HzYH=/$tH舦tHLHI9t"DHGHCHHG PhHHI9uH}xH]xL/H9t!HGIEL(HGPpLMmH9uMHHtLHDžH@H@HH9tHRHPHHHH9uH81E1Hu (LHPHt :LhHMuH0HHtHvLMtMHHt$胾HDžPHDžXHDžGHt$AH8HD$Mt IEL8Ht)HRHHHRWMt,LHRHHH!WHHt$HAƅhtH5lHH]?|1ɿ1_L{PH5wnwH} ^t赀8}H-1P1L OnLSnH51nvXHZ]{fDAWAVAUATUSH8dH%(HD$(1LT$pDO0OI)MIHI ALcI MăuHV:$HtD9-F:$<@HE(HH9HSH HQH HxHPLSHHPfHSHPHHXHCCH9$C(C8CHBLs0S,1ELK@fS(HD$ Lc8Ld$ H} Lo{tA,HD$(dH+%(OH8D[]A\A]A^A_fDLAP1ɺ1H5lOuE1f.Ll1ɺH5l!uE1@L9KH9Hc 8$L)1H5JlHHHt#HH)LM9H5%lH>LT$11ɺSLNATLL$ Ht$tI9XZHt$LL$LT$I#HE(HSH HQH HH#HE1HCHZHSH5k1APLMtYE1^oLT$H5PkQ1P1SAPLMLL$0Ht$(sH Ht$LL$LT$Hc7$HLNP1jSSATsH0E1LT$H1ɺAS1L\$ SAPLcMLL$(QsH Ld$LL$LT$}$%f.AVE1@AUIATIUSHdH%(H$1ILHI|$ L\|Hl$HLt(Uƅx H=wVAID$(HSHsHKHQH HHH HSHCHrH0I9tH]HEH{H;C u1ADH$dH+%(unH[]A\A]A^{8yH-1PL i1L^iH5MG8MtH $I<$1HdVb`HHID@HH $I<$IH];1.`\fHHl$'HHA|"AŅH $I<$IH<1_D$|$HcAŅH $I<$IH<1_Dl$MIG@HH\$HHt$ E1HD$ Ht$>bA9}{L$HT$HLt_$<#LHLEH $I<$MHU1^ID$@ tD|$ HaA9|H\$T$HHE| AEAAA@Au~ID$xtC@@.RfLܝ1ɺ1H5tS\f.IcV(HHtH $I<$1H:^ID$H $I<$IH):1]_DH $I<$IH91].DH $I<$IHa91]DH $I<$IH91z]DH $I<$IH81R]DIG@HifDL`LHID$xƄ$L@L\1ɺ1H5QZeDAWAVIAUATIUSHHLjHco(dH%(H$1D$ AE 2 AE7HTL=_"D$HAT RHDHAT :@tIEHtQIcT$(tFH5|LbHH;MHLHQL QP1[ZYfAH$dH+%(HD[]A\A]A^A_fDLdL=^"IMAD$uLl$0A$ALᾀLLsEFA@t!A|$"Ht$'GLsEFƄ$E1AtUHDHIl@HtBHDD$]DD$~+HT$ H$HEFD$DHT$'H5H @ExL LPMDLV1RHrPQLWH;TZH ADIE(rAEHLL=[]"HLDIHL$ADL$HDD$HAT @t`IEHt IcT$(uLAEHDHADD$H{LDAfH;LH41gYLk땐H5ֻL_DL$HL$D$L=_Lp)DL=Y\"@L$H=LODHqHHMfDD$L@1ɺAH5M1VDL$fLHL$DL$HD$i[H{HIZLD$DL$HL$McH{LHL$LDL$LD$LD$DL$HL$MH51DL$LHL$?bH{IUItmDL$ttHCLkHL$HPHp0L2LH2Q H@0@8AE AEdD$L1ɺ?HCDL$1ɺ`LܖH@0@8DL1ɺ[H5QLDL$TDL$h]_ff.fAWAVAUATUHSHHH $dH%(HD$81B @LBt1AIMwLW^HD$HHD$8#HD$0Ll$E1HD$HD$(IEA}HD$ &IEHD$I*fDx#LM~"YLLH\#L\IHuH} ѶIHf@$AGHD$HtLxMMDyXIUHI}BnF(]Ht$(H|$IaAMZAGHD$08AML|$MfDH} IH.f@$AD$HD$8dH+%(+HHL[]A\A]A^A_SuSH|$WH}LhL艵HH%Ht$L`HD$0IG6DqH5It$ LK01sE1L1.RH|$($WXZ8D[Ht$(H|$ I^AuIGuHD$08u1fLK1Ly1H5HQH5H11ɺL/H4$~QHD$H4$HD$ H|$E1HD$0RVLK1L01H5zH*Q@H|$V1H5ZH1ɺ1LH4$PH4$LKL11E1H5HPH|$U[E1L/H5G~PfAVAUATIUHSGHR t t @uHHA$"AA\D$ MTL/}HcUH5PU"u$[]A\A]A^LHHHcTtLt[]A\A]A^DMA$2i5u+1[]A\A]A^u9b1fD1L/H5yF$O1ADHAI9D$1DHAtHzIt$H`Y1`HsH;1HIIHAEA9$u.LHLH%uMmMd$Mt MufDHCM LHxEMl1tZH;1U4f}t%HEf5H;1)fftH;1UHHcEE1L1ɺH5 EM1S@AWIAVIAUMATUHSHHIpHIH1AEAEAD$(EtvIE(HtmIL$ AE!A} HAtQID$HH{I\$MtMgHL[]A\A]A^A_fDAEu H GHcH>fD}xуH}LLID$ID$ HqMd$wI~ rHIf@UID$ T$ H}IL$ T$ L)-H5sC1E1LIL$ IEAE!BHH5HDHAIL$ AE!AEAIL$ Au fIcEHA fEHIL$ AE!tdT$ H}1AUIL$ T$ HjID$ LcID$ L6,IcET$ 1H}AUIL$ Au T$ H?DT$ H}1AUIL$ T$ @T$ H}1IL$ T$ fDLQ+1H5AtJ_ff.@AWH MAVIH #AUATIUHSHHHH9HLLl$PHDLD$1MEH $脣H $LT$#ME1HأLL[LNLDxD\DLHEH@HHLxMIcLME AU(MIxEWLEAu.fH[H!uEWEAAG uEML,+BH5;@<11E1H0DMML*1E1%H5?HHD[]A\A]A^A_EWAD$UAG Jf#EPIcALEgA  HDmH H@QH|$IIQAHPHP1AH- |$vH DHnAUML)S1ɺH5 ?1E1GAYAZ fDEWAEA AG LHC8?EML_*eH5><11E1BGDEWEAD$DmHH ˫H|?QPAAQIIH{$HO1HH-z$Wt$ H HgmAUMSL(1ɃH5=1F_AXfI} EM-L(<1ɃH5=1E1RFAE(DDmD$HLAPMH pAAPAAPE1LLH~kfI}  f#ERL =fDLo1I9L#DJLDxDDLHEH@HHt LxMEM8L&<1Ƀ@I} L c=H =LEEH-9<L)H<H11AVDXL^Z1ɺOH1E1D@HH E1DeQHy$IɾQL<HAQHMH-hx$Aϝt$ H HjASfDI} H<L )<LDELI'<H1AVH-8;1HCYL^Lx1fDDmD$H/<HH ePAQAfDLcL$LӪL$@EMYL%<H1ɃATf I} H;L 1;LDEL&<H1ɃAVf#EL E;EL :L&<H1ɃAVAWE1AVAUIATL%H"UHcSH\HLHHHt$Lt$LdH%(H$1{t'M1L&H5x9#BHDE1HIAD$ @utM1LAT$As LLpt5H$dH+%(u7HĨD[]A\A]A^A_DE|$빐H|$DL gALfDAVfAUATAUHSHH0dH%(HD$(1H|)D$HD$HF HD$HD$ H<$H7Dh@1HL$IH-H$EHHD$L5.8HIL%1P1L@XZH<$Ht Ht$艷HC HtDhHD$(dH+%(H0[]A\A]A^H8HHED$L57HIL81PyfDL5u7L$L@H$H8EtH8E1[JL5/7fAWAVAUATUSHxH|$Ht$ HT$(dH%(HD$hHHD$HH$HH $Ld$0HHL$HIHH $L=HLInLt$Ld$0f11LLIF)D$@)D$0HD$H)D$P̚HH|$Lx H@Mf.A?vMwA<@u AFIYHD$L@L9uCMmL93IuLIuHD$HHD$f1L1)D$@)D$0HD$H)D$PHHHD$LxMteMMI} tIUHEf1L1)D$@)D$0HD$H)D$P赙IHyIU IV MuH<$HHD$ H\$(H@HSHt!HtHZH9XHPHD$hdH+%(THx[]A\A]A^A_MMsH<${I}H5cGLEH5$LLD$GLD$uI}H5GLD$tIH5tLgGI}H5EH|$JGtH|$H55GIU HfDHH@HuIF HAHEHH@IEHELhfDHD$ HHH@HL$HAHD$ HHHBHD$L`M0H-*!f.Md$HD$L`MI<$H]FtMl$MI}H?Fu{IEID$IDLmIEJIHD$H|$ HH@8HZH9XoJHf.M[EAWIcE1AVIAUE1ATIU1SHz@"H($HHHT$HHL$HD$18DILLLL HLEHHPH(CA9$uAT$tC utC uAD$wPHAD$f9C"wts0Vf9rMtS{YELLLLTuAD$f9C"Fts0Vf91MuLD$HL$LLHT$D\$D\$HI}L1rH509H(L[]A\A]A^A_f.H K At$f9s"tS0f9} ]fIL$Htj)GC =AD$f9C"@AD$f9C" S0frf9dL1&H5/8 2DAVAUATUSHdH%(HD$1H>HH/HA(AIHu`H0IDHLHQL$$MEl$HD$dH+%(HL[]A\A]A^ILF1E1H5.7@1E1L0H5.i7}@H0LDHH 蔳`H$HH;(IHfH@ H@DhAWLcAVAUO,ATIL%2&"UMHSHHdH%(H$1HzuH0D$HuHHD$OLt$@E1LILMALT$LT$Azt'MI1LQ H5] KHLE1P @ut\HHPAAu LHN|$uAH$dH+%(JHD[]A\A]A^A_DD`f.H8uHt1DHPHHtHHPHt;2uHPHHQH8H@fL8IcHD$Mt\Ll$DMMtGIf11LL)D$ )D$HD$()D$0}zHtH@ Htu D`HL1Mt$L 1H5#XZ@D$fDH%(ff.AWLcAVAUO,ATIL%#"UMHSHHdH%(H$1HzuH0D$HuHH D$OLt$@E1LILMALT$kLT$Azt'M`1LH5xKHLE1P @ut\HHPLcAu LHPL|$uAH$dH+%(JHL[]A\A]A^A_DLc`f.H8uHt1DHPHHtHHPHt;2uHPHHQH8H@fL8MtdLl$DMMtOIf11LL)D$ )D$HD$()D$0wHtH@ HtuLc`HL1MATL1ɿH5#XZfDD$fDH%;&ff.ATHILcMtUI@BvD#ML4H5PHo#1h@B 1ɃZXZLA\fA@BLA\@USHHtAHH~Ht\H;HhtuHSHHPHSHHCH[]1L\1ɺ&H5H1[]fDL\\1ɺ)H51AUATUSHHtmHIHIH9u:f.HH9t(HsL$uH[]A\A]HLHL[]A\A]1L[1ɺAH5 H1[]A\A]fAWAVAUATUHSHH6L"HT$HvL9tjI@Mt$LLHXH|IHt|HLH'H]H9u CHH9t8HsL#uM$$L;d$uH[]A\A]A^A_fLHLuH-()DH-1ɺA1LZHH1LZ1ɺsH1[]A\A]A^A_ff.AWAVAUATIHUHSH(Ht$L$LHg{IH4IFIHD$8IXL)LHpI.{HLLH7&LLB(HD$L|$uBA?tTHLH HL$HuLl$LLHD$vfDIHHLtA?uH(L[]A\A]A^A_L1H5lLLE1>@LX1ɺH5O9H-A1 HLAH1LFff.UHHGU0HOH8t]LM LE(uI<$MHDuHT$dH+%(uH[]A\A]A^fD@AUHMATU1SHHdH %(HL$HOHt)H8I-AĄt H$@LHXH_ H<$HD$dH+%(uHD[]A\A]SAWAVAUAATE1UHSHH(dH%(HD$HGHtD H}L7I H9tHAL|$HD$4HD$LDHx H|$BH;\$tCH}HMHD@uHT$dH+%(uH([]A\A]A^A_D|ff.AUATLghUHoXSHHLH輸@H{hI9t2HGHHBHGuGuH H{hI9uLL;t#L-fDHC LHPL;uH9kXH[]A\A]AVAUATL%USHHH@HdH%(HD$81Lt$Ll$,t$,HLLHD$H;tDHC LHPH9uLLD$HHHD$rD$u!HT$8dH+%(uJH@[]A\A]A^@HHL$0LD$ LD$ HsHpntD$ )D$f.AWHAVAH1AUIATUSHHH?H/H HHII1HHHHt2ILDLI)I9LGLD$AULD$tXM|$L)tfH1DLHN$8HLLAUt+Ht>IEHIL[D]LA\1A]A^A_@H1[]A\A]A^A_H[]A\A]A^A_@HDHL$0HL$1fDAVAAUIATIUSHH5HWHDHHR HH Hu,EE1Hu6[D]A\A]A^HHÀ; HAt8b M1ɺPHFLFP1H5t5XDZ[]A\A]A^Ed E18 1M麄PH8H5PL?F1Y^$@H?M1LH5бE1E+ 8t M1ɺ~PHLEP DAWAVAUATUSHH $HH $H81ҾdH%(H$(!1H!AA9t-H1ɺPL-L1LAXAY1ҾHLhHHL1 \LLHu#H5&51ҾHu#LVM-u#K1ҾHH`5IHtmL5lmHL H5JLz RL1ɺ Gg#LL: ufD#1ҾHLh"HueHL1ZLvh"Ƅ$ L-L1ɺ1L%$ b#1ҾH1h+1ҾHH 1҈H5_HIzL5kLL`x1ҾH|HHt!L5kHL"H= H1ҾH1ҾH|81H1ҾHu1ҾH]a#`#RLU1H51ҾHH 1҈fH5H8HI 5HLH tH5L hHxHtQL` MtHHfDA<$u ID$8u ,H1LMd$Mu1ҾH67H 1҈H=!L 1ҾHL q#H 1҈H ЈKAą1ҾH31Ҿ%HHDžH!1ҾHD L5hHHEtH5|HLHH5HH5;HH5-HH5HIH5H2H5/HA H1HH>L-oHt 8#ILY1Lc1f1H)D$)D$ )D$0)D$@)D$P)D$`)D$p)$HuHLh ME11L=!L5DfA}u3I}LH|$XH|$LDADDMmMutpH`HK]#L$ HLHHD1TxRLt$1ɺLLKt |$THHtEtHt 1ҾHA+En#1L)H51E1H$(!dH+%(=H8!D[]A\A]A^A_fDfDH$ H!\#1-UDL1H5f<L-1ɺ1LL L11L11L LuL1Dž|DH5HqVL-PI11LLr*DL;1ɺ=1H5GpfHL-I1hL21LYA^H$L0L8@L1ɺL-1LHHZj#D1ҾHL5cHHfH$ Lx$8%=@L-M11LpLƅh"Ƅ$ f.HH8DLEPL-I11L_UL1H$Luk$%=`mL81ɺ"1L-L7LJL1ɺ$L1-H8L81ɺ1L-ȜLsL81ɺLIL1Ls1ɺ{1ҾHL$ HHLL-E1PLHl8h"Ƅ$ H;$L1HHOLSH5HIHH +$L5*$L=ifLHPIHtxLHuH=*$L$uLL%*$uIM1H$ LH?Ƅ$2LttL-81=z:$LHYIHHDHH |7APL D:$LXQP1H IfDLL-v1L@HHt7H4H%1HuHHuL-H=*H5+fHT$)D$L$L$ HHXD$'LPD$.PD$5PD$-MtL;H#LH$LDhD1H<$DL谜HHdLhMWMHA#LH$]LDxDޚH<$DL]HHYLxMLH=ݎ#OIHfH@H=#OHfHhU`InsI?IOL8LHHIOHIGU`H@LA 8V1L.PHH5nPLL$ 1'XZLL$1E1LH5.L }L$@ 1MH oM#H'L0E0L$@0LLL$wL$1HL$8HT$4LH5JD$8Lc|$4Ht$ LDH|$ )!H|$ 'HH+\$,HH|$HIIHLHtHH1a!LgIHu ^D1AL!IHt@LwHHuML1L-1OLIHuLHHH3H|$ u%LL$L1LOHD$H,|#HHD$H93H5>"HD$8qH$dH+%(H[]A\A]A^A_ML1L 1`$H|$VLL$LRLT#.fDMLf1L&1DLL1H|$ k8H1ɺHPLL$ LLL1ZYfDLcLbHH&#HHD$D$,wH$dH+%(uH|$8H[]A\A]A^A_A|f.fATIUSH/H]H9u;HHHL9t%HHEH}HCHHtր?tf[]A\ff.ATUHSy@H˅yE []A\fDHQDHt H9L I#H1RL%rL9L)uEZYtHu1ɺLLeH{ HkH{HH9SHGHCHHHH9u[]A\LHJff.@AWHAVAUATUSHHHD$H9ILfH@0@@ L}L=I|$LpL 9HLLHI$HC(I$L+HCI$HHmI$H;l$tUI|$88HHZLF1ɺ1H5ȃH1[]A\A]A^A_H[]A\A]A^A_@HC(L1ɺH y$H5H=UHoHI1I#uH5aH`]fDAWAVAUATUSHH $HH $HfdH%(H$$1HH$)$HH4H@ AŁ%A D(=H$1AEH 5#HoH-HZIHLHt-x.tHHH$1HJL-Ld$^L 1ɺ{ 1L$UH5AUMwL_AXHXH=1u#HI6H H$HxLHHILHLHH)H)HDD9j H5H=`IHH$L5LH@HtYL|$1HLHT$MLD$H uD9l$u9,$u1LH$H+L$u01H$$dH+%(dHĨ$[]A\A]A^A_DL$HyH1PML UH5 1AUH LHX`L\1ɺ 1H5Ƅ$0f;8 L 1PHLPH51SXZ@L$1AEH 2#HL*H\$1ɺLHf|$..L$HHt$H/-wHH ЄtL@9$&ATfTf.8DI1ɺx PHLPH5S~1AYAZZ|$L$1IؾH UC#HV(LV)U1H5}1AUMẔ LLH=hq#YHX^Hz2H;H$HxLHHILHLHH) H)HL1ɺs 1H5V}Ƅ$FL1ɺ 1H5(}$ۉATT6fDAWAVAUATUSHH $HhL=H$L`H\$8IcLF8IHT$IHH\$PDL$dH%(H$X1HD$ HD$HMH/#HD$HD$HLDHEAt$A AHALLA A1s'^_9L$H11DžHT$ HD$0|$0D$4HD$(TLT$(E~fHD$8L$4HD$ DH$XdH+%(Hh[]A\A]A^A_HT$ 1HH&t}uH|$HulIHT$L`uSLD$H8\I1PHgL3PH5{1XZLT$($19IEHt7L9t2LH1LH5|z1L )>#fATLcUHH~SHHHHDH=H) 1HHHtqHP@< u'JL%H9rSf.H9tDBH< tt4< t0L1HH)H9rD< tHH9t  D uBD#[]A\ff.AUATUHH $HH5'dH%(H$1Hh22H/IH$fDLHH$#t݁}VERSuf}IOù}NuLL-OtL 1ɺi1LIHLH-)@$TH11UMLmLHLLH$dH+%(uGH]A\A]fLt1L 1ɺvH5%#11L1ɺ_H51yfH=k#Ul#tML@1H5wH-k#HUuH/HHk#H=zk#tML@1 H5w\H-Mk#HUuH/H>H+k#H=k#Ht"Hk#]DAWAVAUAATUSH8dH%(HD$(1:#u.HD$(dH+%(H8D[]A\A]A^A_jE1E11j11 jj< HD$8H HHD$HHPAL$I$HA|$ LE1DAHƋFuIcHT$HHHEL)H7HT$HIH@H\H1D$<L$I?IGL;HCIGHAD$I_IHLC0IHY,HSLCMl$ C LHC(LD$H|$LHLpLHl+8pHlKt5HC FOLvL;HLHPHT$'HT$Hk(D$HlHH|$D$kHh#L%uHD$HIHL9HD$HHL$Hl$H9ufDH9l$LeHSLk(Lu(I9 LLHT$HT$HHmHtL9uHmL%[tH9l$[#(L=g#H(@H@H@ Hg#KH@]L@LLl$$H@Hl$(H@ Hsg#1tH]g#HH9uHH;Fg#L5Ig#HCLHI~ȉD$$IHLHw7Ls(A>tLH=f#HLH耈uL1LE1gfHL$H9L$L%r@IH-H@H|$H詍@f#A}H M@%L2 PD RAA%AAU к9P1ATL%,rLH0fDL|1LE1cDLT1ɺ)H5tL@1IH5qpLAbL1ɺ.1H5A55#L11-H5H|$:'H ng$H5EH=VHd#Lw1ɺZ1LE1!Hd#@HtHHtH9t H@DH94#UH H=8d#dH%(HD$HHD$H$HHD$HtH11DL$EH=c#Htz$H-c#HtHUuH/(HH=c#HtpH=c#HtpH-c#HtHUuH'HH-c#HtHUuH'HoH8c#1H׋T$H1HT$dH+%(u9H ]f.L1H5Ko rfAW(AVAUATUHH=USHHb#orHb#H(5H[@H@H@ H[b#nHWb#H.tnHEb#H(H(@H@H@ H(b#HdLh@LH@H@ Ha#H=a#L`L"HHLLHHa#HHa#Ha#Ha#Ha#Ha# 9HHHP 1L P uD IcHRDuHuH=pIH<DHH!HD$HHD$H[ H,Hu,d@LLHHH[HEH=LkLLLxL!HuHELH-l1H^L 0H`#fDH= `# 1L1ɺH5MlH_#1H[]A\A]A^A_L1ɺH5 lѽH1[]A\A]A^A_L 1L`1ɺH5k蘽L1H5kHw_#bH1[]A\A]A^A_@H-vkL"1H!L1ɺ1HfL1H5kH^#ѼjH-j1ɺ1LXH証Lg1H5jH^#wfHt$H=4^#DMHm^#HtDL8H-]jLAHLL]fDUHSHH\H]#HxH9t!HH}H9t H1[]HDtuHGHH[]fDHGH[]ff.fAWAVAUATL%iUHSHL7dH%(H$1Ll$IL9uIf1ɺ[LLIIFHBHHIH9HI~LHU8HD$8uH9tЉA %ALA LQ1P Av% кWP1nM~H LnH=/\#LI HwH|$wH|$/(DH$dH+%(uHĸ[]A\A]A^A_nff.AWAVAAUIHATUHSHHdH%(H$1IH@`uxH;L|$ HLɾM $M9D$8%=`pIL$8Lt$HLL$I9H $Ht1LHLH$dH+%(HL[]A\A]A^A_fDL|$ HL(uD$8%=`ELc1ɺ1H5f覸wDHt$LȉD$HZ#Hx_zE1H $LL$I9*DAA A% H*#MtIQL$HAɿUALPA AVL5>f%RL 1P1H0LL$MHD$H % IHt L9HH5a)#IR8L$HULPQA1PA VAL% кP1VH|$0H0Ht$HHH;IHILL1IL1ɺH5 e1E1ɶ@IL&1ɺqH5d1E1虶j@I$H3I9*HPID$8HIRL-dLL % 1RzP1+H H/HW#HHLHsHts1ɺ~LLI$I9u,fDHI9tH{HL1譫AĸHL$LA9DO1JEDD$HHC ME1HD$E$IcLHH1AIL9d$u[HC ME1HD$fE$IcLHH1A諪IL9d$u HCME1HD$fE$IcLHH1A[IL9d$uvfDAWfIE1AVHtTMAAUATIUSHHdH%(H$1I)$HN` L)D$)D$()D$8)D$H)D$X)D$h)D$xjL$1< L:tu z1HcLLFDc`AAu!11HKLXHMtIAH$dH+%(HĘD[]A\A]A^A_DHLE1AjHKSLHAXZEt$E1t2fz0BHcLLS8fDHH|ADL1ɺH5&)#菦ff.@AWAVAUATUSL$HH $L9uH(fdH%(H$@1IH$ )$)D$HH|$ HfwTHHHcH>fHv8L$IAL@  GCL$fvwH$tCL$L@"t讠HfX tE_H]Huڀ$E1@L$E1LLHl$LHH|$_H觟HDH9wHH9t8_t@f,HLldLHH$TLIHH$@dH+%(#H(@L[]A\A]A^A_Fb@H}HH9HSH?H9G9uHsIwFa@.H}HH9HcSH?H9xG9uHI|$t|$1|$0H5H0HHoif.H1MUL 1ɿH5IJǘXZlH$HALjE1HH$ _AX^fL$HE1AjLHLH5LhY^HYf1E1D$H$ L$ HHALL)$ Hj!A\A_$ L$tLL$HALHHD$ AHLPAZA[tDL$EHtHEHt H9bL= #H5fL誚uL/HD$,HPHLEA/@蟜LD$H1A,HA,@t HDQtI`Hu"H$0HݲHHHD1 1ɺLHv$ LLpHH9 H=#HtHxIHL1ɺb1H5  DHeTLx$ fDI9LGH$ fuLIt?B<8 tMt3L HIt#x tHpLL謙BƄ<$L8H]L1ɺ`1H5$E1LD$=L1ɺ1H5UDAWAVAUATUSHH $HfH^ dH%(H$1IL~ H|$I)$HL9L-fDftH{u4HL9tckftf uH{HtLbHuftAH$dH+%(HD[]A\A]A^A_DLLHHt/HH5JHHt̘E1軘낺LLHID$8I;W t}9W 9t+AD$a@tE1ID$I9D$A&LL,HHE1AjHvLLfZYtHA LLHH)ID$8II%H A Hc>AŅt_H5HNH5H7H5H AT$8IL1ɺ<1H5肜fAWAVAUATUSHH $HHdH%(H$81IHHHt$,I蝿t D$,9Et0E1H$8dH+%(HHD[]A\A]A^A_Ðf}L} Lt$01ҹLL蚜HEfI\$ IL$ H9t"H{HtD}fD9{_HH9u߾ HL$+HL$HHkULLHL$UI|$ HCIfS7ID$(HL$HCH HI\$(Mt%LLHL$T$T$HL$]fAD$`@@M|$ID$HD$I9u@M?L;|$zI_LHL$H覚HL$AuҾ +HL$HIAT$`aAGAw H5RD,fEjHLT$HL$T$肙LT$I|$ IB HL$T$I IL$(ցIJLсMT$(DLeHH 3MT$0HAT$`HHDAUfwIJ4)I$HRL9IHzUL 3DBfAwHL LT$L1ɺ P1AVH5ɨWAVĎLT$(H ABfEDƄ$/:_L苗H2|$0_ LIDL9wHL9t8_tf}@|$0t|$11|$20H5L3HLr^DIMt$8X I$Ht L9wH5"LH D%91ҹLLHtI9*HH5Lt H5LȐHt$0L胒{Ht$XI%;B \ID$8  ʉ@  9.I $%HL9 LIVL\1R PAWH51覌H f 豗HHLm fHL@I|$ HCID$ HID$(HCHI$I\$(LeAL$`I\$0HL9HHEL 0PfwHIQL1ɺ AU1H5ޥA֋XZL@I$LeAL$`I\$0HtiL9tdHPAGL 0fwIMRL1ɺ: AVwfDHpLZf.H "H"I$LeAL$`I\$0Ht9L9t4H@JL /fw HIPL1ɺU AWH"H="@GLHL$HL$0%AGAH5ݪD,ID$8 % I $HtCL9t>LIHL1R PAW`LLHL$AD$`HL$L "\L1ɺ 1H5ͣˉ L "LV1ɺ H51虉:L+1ɺC ff.@AVAUIATIUHSHHHv8HdH%(H$1HD$%;G 9G tj9B9GLLHD$H>fUHH$dH+%(HĠ[]A\A]A^LLHD$HufLL`Hu@HT$tHD$eIu8Lt$I$AL@  3H5pLL谑HDLLHD$H LL HD$H LL] HD$H| LL: HD$HYLLHD$H1L1ɺH5Iu8I$AL@  u2LQ1ɺ*tZH5L$t LXHt,fAE8I$%@L1ɺ2H558AE8I$%芐L1ɺH5 fDAWAVAUATUSL$HH $L9uH(fdH%(H$F1D$lD$hD$d)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$u8AH$FdH+%( H(FD[]A\A]A^A_fD1ۀh2Ht"H$6Hh21HHAL=#L5yLjHLHDʀ=#IEHAQA1RSRuP14H0<LL1M9t2fI}(HtI} HtMmM9uD-#E=0#t41HL$hHT$lLLD$dH5Ҡ|$lHh1H$HHL$8H|$Hh21H$HHL$HH|$bH|$H|$H5ߏHD$(H H|$11D$49H1L9tfHL9uHcD$HHt$@Ht$@HHD$  LMtLzL1Mt ;\$3D$dAH$HHH|$@DH1~DT$LL$@Hc1H|$ LHA)IcDT$PMDT$PA9D 1LHH|$@LD\$P7HD\$PI9Hl$XL|$ DLDl$PgfwHM 1Dl$APHcLQLPA)RIcH1袍H LlD9HL9HCHHHH9HBf.H8/IEHK0Ht .tuLHS sL )%DCHҍ~IDE"fwHM 1Dl$HcHLQLA)PIcRL1ɺ1L3,fDHLeH5LjtH5LRL%"H"I9tE1L-fDI|$HHtLtM$$H"I9u҅"=#LLh211LT*8 +1LPHLoPLL$ 1XZfLi1ɺ1L~L1ɺ1L~LH|$ H1 =L"1ɺ1Li~fH|$ VH|$(謉|$41އ8'31LPHLkPLL$(1}XZDHC(H"@H@L\1ɺ1L}I8蒄1ɿLPH:DLֿPLL$(1g}A\A_H|$(蹈t98I1ɺ0LPHLPLL$ 1}[]|$4 L1L.|ADl$PHl$XHt$ IcD$@L|$p1D\$PL$pLHD$p|Ht$LAH+HHIVSAPLPLM1ˆH D\$P-Ht$(HLD\$PƄD\$P)Ht$(H|$ D\$PD\$P-H|$(D\$P越D\$P6H|$(D\$Pj|D\$P5H|$(D\$PD\$P;Ht$HH|$D\$(趉D\$(F|$4D\$軁D\$N|$4D\$|D\$ HD1ɺ'SLLASD$ PLL$`1{f$HDŽ$DŽ$)$)$H HH|$ L1Lz*L1LDl$Pez= #}LL~119zHAW DڿϦD\$PHD\$PD$IL1L$y}L1LyX L1Lږy3L/1ɺ1LvyL 1ɺ1LTyL1ɺ1L2yH|$ (~LlL1yH|$ }a1ҾHXD$(H$&HL$8HHD$H1.rH|$<@LL$H$6H0LHHL$81DKMHHH5!H IHHLMH|$ LLІLx9~{L)IL 1L1wH|$|HD$H E1H$E1E1D$HD$8D|$4H|$HH4{.tL{LN|H#uHC"fH|$81)$L$ H$H$C+LT$P$C/)$f$C2HDŽ$$膄H 1HD$HpH|$P 1HD$@XLD$HAT$AA9vHL$@E9A9 1ҹ$LDT$H$~DT$HuƄ$D$4AADT$L÷1ɺ"1L vD\$L1ɺ 1LuD\$LL$1ɺLLuDL$LLzuH|$(=''8p|LƷ1ɺPHoPLL$L1EuY^Lڶ1ɺ1L!u[D|$4D$(D9cH|$EA)*}AŅ Au$H5F*H|$H "Ht$xH]|H5^UAQL|1ɺ3ATL1U1AWDL$HgtH JH;H t1H;H t;t;H tH;H ufH;uAUATUHSHHH9tIIL-} HH9t2H{uHs(1LnHCHtHH`H9uH[]A\A]LK(LƉ1L lATUSHH $HHtdH%(H$1H$HHhH<HHpAąubHh2@1HrDž(mAH$dH+%(HĠD[]A\@ILVs1E1H5k@1E1LlH5jz@tH1ɋILbH5P1jXZ?fL<1ɺ1H5jtDAVAUATUSHD%##A9EAվ1H9AHH=LMUL5#1HLpD O"EDAABL1pAąBDpD%"A#*ALq11H5^E1YiHD[]A\A]A^fAHtHD[]A\A]A^1Lq1ɺH5hHD[]A\A]A^L|H5ł1hc@1ҾHHD$?HL$HIL/1ɺ1H5trhDr1ɺE1DLq1H5>I}(Y^HtCM$$IE(D$HM9uHD$PHtT$HtD$LD$HH$dH+%(+Hĸ[]A\A]A^A_fDA9Ld$HmAH;l$ LHtHHt H9FL "I1ɺH5W1=HU1LIHPHuHHH/HmL9ML9uW@M$$I9FIt$LGuI~<HfHhH$H$HL$HPH$HHH$Ll$8HD$LH0HD$L M1ɺH5Vp(1S<_AXeH@MLHIH [LLHC LE1SE1[D$HILGAbHl$pH;l$( FL}1ɺH1H5V<H f$H5=H=N>ff.AWAVAUATUHSHHt$8L$T$ L$@LD$PdH%(H$1H$L$L$HD$H$H$1D$ |$ u @ HLE1D$(D$L9bDD$$ϦIL-TD$DM$$M9ML$0MtI|$u uD$ u fA|$u11L-Y>L:H}@hHtvf@ H$@@0IT$0o HoRP(H$It$0L8|$$D$DHPH$H H$D$$M$$M9LAH$L9Ѓ E1ƒfDHLJ1ɿATD$(H5SPD$@PD$,P1ROy9H0L9$u  LW1ɺ]1H5?S=91VIH D$pϦD$tf.LH蕅IH1AEbuHH k2LHHtHH <LHHtHH VLHHtHH VLHHjH}\HSfLhH$H|$Iu8D$tH$H8|$pHPH$HH$D$pfD$ D$`; 1LoK1ɺTH5Q7D$0D$@H$Ll$8L9tUDLcMt?H}聚Ht,fL`I} IUL(HPIUHIEHL9u u/D$ D$@u%D$tH}H5VA DH$dH+%(H[]A\A]A^A_E1ɃHAL9uID$Hth I<$;L; u0D$ u(HDD$pL$tT$$t$DY LG1ɺ1H5QPO6L$L;l$IH\$(Lt$0Dt$L|$L|$MeEtLH,MI$HL9LH1H5O1LT5H$L0E$HH iLHHt\HH [LHHt?HH <LHHt"HH SLHHqMt AD$aMmM9H\$(Lt$0L|$L$H$D$D$0D$`HD$hM9L|$MMfMoM;IEI9.L5O"HtLpHD$0IwI9DHS0HH HBH3H3FH HJHBH3NH3FH HDŽ$E1fD$ u |$ HL$hH$LHwoH$HHD$(=LHD$X=HFHD$H$HfLK0HIL-FH5vMMLDȃ="H1AV1t$8RT3H a>IH<H|$H0H|$($H|$XH{ 8H{(7IE HHD$`ZHD$(Lk$HC HD$HfSHC(HD$XfAVIFAM`I} Mu0" HD$`HsLIIE(IFIE(L0Mu(P`D$`M?L;|$|$`L|$L$D$D$@!D$ M95L%6E@M6M9MnMtH1LHHPH1LHHuA}dbIUINHL9tLJP>1MQH5K1ɿ1XZHtHCAe``HI9 1DD$fDL "k@L "y@At$XH="*L/* f.M7I$H*L9!LHLB1ɺ1H5J0HHH$HD$LH9wM$Ll$MDt$HIHl$XLL|$`IHSHC L{H3EH3UH IWIGH3UH3EH HCHMaI$HTL9KHJHHNH9EHBQMLA1PH5I1/A[LAX1ɺH5I1/1MLA1ɿH5}I/HHCHBHIELM9Ll$Dt$HHl$XL|$`)D$pϦD$tD$D$01L`B1ɺOH5 I/D$0D$D$@HD$PH.|$#L "@HH v"HHf"LH5h^T$$LL8H5ΙLE1D$(8H5%LA8HT$$I9D$)fDLHT$xf$7LHD$(H$7LHD$X7H1HD$PH5G1H$ML@R-^_WMtI$Ht L9HI"HML@1PH5dG1`-LcAYAZD$@D$tD$D$pϦD$L@1ɺQ1H5G-HnL1H|$(1H|$X1H|$H1Lon11 H5F,=D$0D$@yD$DD$$ϦH@HTL- ML50H55KL.9IH1H=L1B3Aƅ1H#:H$H$d,=m#IHIHDZ0HHMLAWAIH?1-AXAYHJDD$$L$D1L-DD$pL$t1HJL-LZ:Å5L6t5 vH5LL}9H1ɺD$xL?H5 EP$PD$DH1sH57D:*L5L-; 1L J1LWlPwHFPH5C1)AZA[{38c0M1ɺgPHFLkPH5C1)A^A_(Lk1ɺ1H5aC_)u31ɿL=DH1H5+C.)L,);0L I1L[kPHEPH5B1(ZYHH5BA1PL=1(Lu,^_F28/L I1LjPHTEPs2 2L <1ɺnDH59B15(;)/L H1LvjPuHjPH5A1']A\AWAVAUATUSHH $HH $HH $HxdH%(H$h01HHD$H;^Hh21ɺ1L-oAILFIL]'H5 H.4IHD$L$` H# HASH=0D$D$$ϦD$fLLp+HI9,$mA<$# HAo$` #tHSYSTEMIDI9$tL+<$L H5EL$)y H5EL)eH5d@L)YH5ELZ-H5ELHH-H5ELHD$ 4-H5ELHD$H -H5ELHD$0 -HD$8HH|$ 80HD$@HH$`HHHD$(8Y$`JH\$(H|$ HY$`<. H1!/HL$@HHA H|$HHt(Ht$(X$`t <.ODH|$0t(Ht$(H|$0X$`t<.lH|$8t(Ht$(H|$8dX$`t<. IpHL$@HD$HIHAHIsD$cfA|$SHL$`LLLD$W-H|$ 1H1D ED$LX/HL9L1ɋD$PDL$1#^_DD$EuyL$9 $tA L$u0AT$D$@H$h0dH+%(D$Hx0[]A\A]A^A_A@fDLd1ɺ1L#fDH\$`LHV1L1IٺL'B"I~H5AC-AID$HHHHT$ -}|$`HǍLHEHL71HT$(I1R#C"A A[[3L&A1ɺ1H5<"D$fH\$`LHU1L1Iٺ,L@7!I~H5@;,3AIHHHHT$ ,D$u|$`HHT$ HEIHL61LR81;!A AYAZD$"fL161ɺ1L!D$fDHY#LHyTI1ɺALB@L1 @ L61LA1 @1ҹHH=u#+H#D1fLt$PHAH\$(Ld$XILH*AIfAuLt$PLd$X1HD$@fXR@1ҹHH=#*H#D L51LA1D$H|$(*xHL$@HA0HxHD$8Ht>H\$(HǺHR$`<.tt 1H'HL$@AfL41ɺ~1LH\$@H{ #H{(#H{0#H#H|$((HL$@HHA(DH|$( 1&HL$@A|$`KHɉIDLd$XLt$Po(L=31ɺ1L7D$1ɺQLL3 D$D$AVAUIATUHHdH%(H$1ClAąXIAt;Ah2mL41ɺ1H5lA@LH"D$%=`I L8H5S1E1H$dH+%(HĨD]A\A]A^fDKFIAąmLi^1ɺ1H5f.Ht$(H#6AąH`HAATHL8=DL]1ɺ1H5n/f.Ih2LQ!|A%=ALAą1L2 H5A%=#yL(lL]1ɺ 1H5WCfI L:11ҾL诰Aąu0L11H53AA%=c-#UL(H1ɺ E1L-\H5~j$@ATUHHdH%(H$1hAąt6h2L01ɺ7 1H57AH$dH+%(HĨD]A\D+CAąuLP[1ɺ, 1H5말L,[1ɺ1 1H5of.HHh20%=tw:H2Aą1L/B H52%=G#H7&f11ҾH?Aąu0LY/1= H5A%=e#WHA%J"ff.@AWL#/1ɺ AVL511AULATUHSLHHI9WL=fCfHSHEHs(H1ҹH]HHtqHH6HS0HC L KHs(HID׍yHIDfwHN HL.1ɿVLR P1H 1)IHDLH}cHHBbuHH萩tHCHtHHt H9tHzH=i"HS0HC L *KHID׍qHIDf{HL@61WLR4 P1WID$H Hth I<$<L4@HL9dHL9L%bL=c@HHH9HRHC0L L-HIDH1RU PVL1H HL9f{uHs H5HCHu1ҹH[HHp@bHHHS0HC MKHIDԍqHIDf2RL,1ɺn PL1HY^L9TtsHL9tgH-/L%bfHCHs@bu L1x_AX@H5)"@H"m@HC0SHK(HHDftgHHs zMHHDfwHN "H QL+1P1VLHH L9 ]fDHt;HI QLG+11LHXZL9ILF+1L 1pHL9HC0L ]M L)*HID1PATHK rMHHDfv6PL" Q1O@HN xHN 9HPL"QN "1ɺ fDHHt H9!H=h"HS0HC MKHIDԍqHIDfwHN 9HL)1WRb PHCHtHHt H9tHzH="HS0HC L KHID׍qHIDfv^HLp(1WR PHS0HC MKHIDԍqHIDfv(RL(1ɺ\ PLJHN HRL(\ N 9P1|HxHCHtYHHtQH9tLHzHS0HC MKHIDԍqHIDfwHN 9HL01WRh PcH=܁"f.ATUHSHdH%(H$1i^AątSh2HHt :aL"&1ɺp1H5xH33AtH$H$dH+%((HĠD[]A\fD8AąuLP1ɺV1H5*fL|P1ɺ[1H5vf.HHh21 %=11҉HAąL'1H5s4HAjDH%=h2gHHh2PCHtc2fuD%=߃#Hf.HXu1E1L$H5\ %=D%p#EHE1\11ҾH_AąL%1H5ߺ W@LeH5,)LtH5)LIg1E1Lh2L,H5D pHLJHfHLJff.ATSHHHtLHL[A\fDL%Y"Mt4HW8bLIHtCHt_LfDLL1ɺ:1H5,/ DLL1ɺ=1H5, afHHt8H9t3LHB1E1L6H5S, "L y|"SHHHtgHǃ[DUH- ,SHH@ uTHC@HtH9u0L |"HHL+1[]# LHf.8HHtH9u?L {"PHŤ1PH-k+1L-LH XZX@LJfAVAUATUSHdH%(H$HH H=w11H$dH+%(H[]A\A]A^H IHպLLHLT$==ILHLQY$=t =SL1Dt$D$8D9A9H9HH-H9$HRHMRLt4AVPefL1Dt$D$D9t[A9tVHtHHt H9Hy"HMRL 4uAVPH5"1H `LeSfLlI1ɺhH5"1+f.HR~L,I1ɺH5z"q1f.Hy"ff.@HHdH%(HD$1HtH1HL$ht<|$LUKSt"HT$dH+%(u@HD1f|$uLdH1ɺH5Z( ff.fAWH5=AVAUATUSH8H|$dH%(H$(1;HD$ IH$ D$LH HE1B\-E tքt L8HADG u^#tMc{ILHtaH5'L- ty H5'L ED$D$`IIkJf.}LcHHD$t)D$ D$@D$ \$ \$ tH5L7 HHD$Ll$ @ALHAMc117fu<"tPu PπgHcуD IA1BD5< t't#HAWf tfu <"u'>|$ JH &t$M1P1L:&H5 &2L: H=#YHX^HgHHt5,tD$ tADfDfDH=#H5#5LYE1ɺH5%ifLuDH$(dH+%(H8[]A\A]A^A_fLD1ɺ1H5 %DH$t$M1PL$1H5$LH=#LpXZLeHHt;AAEt"D$ AtECD5fBD2fDH=Q#H5*#\$9LD1ɺH53$JD$ HD$ HzLHHILHLHH) H)H/HD$ HzLHHDILHLHH)A H)HGD$ ۉADDD$ ECD5BD2 ff.AWAVAUATUSHH $HH $HH $HxH|$HLD$ dH%(H$h1HH$HF8<AL$`!A LAL%b"AA LH"1TZL$`LLH/LƄ`L@H1LH"LYH$LHHD$AŅp$%=@eLuIHHD$L$`HhHD$LHx.HXu{t߀x.u{.u {tDHL$1IؾH*XL*YHt$LH$A‰A AA H$t$(DT$<9p H=߅#HtgAHt$1ɺH1E16@ML11H5 HxGLy)1ɺ1H5UgbfHEHH9LHHL)ARD$8H5P1AWH @HEHtxH9tsLHRH51AWL(Y^L(1ɺ1H5E1L Im">@L 9m"f|$Dh-HET$LJAULPH51SXZDH[]A\A]L `"L `"P@UG@HxqGD~GDuHx]ÐHEHt7H9t2LHL_1H5VL i`"HHtH9u3L L`"1LH5h1]@LHf.AUI1ATUHSHH(dH%(HD$1MG"HlH$Ll$HRHDHHUHH9HRHML%SPLt1LRS~"H u}@1Hw>HNtjAHD$dH+%(H(D[]A\A]fH^"e@AL.11H5 f.1ɺLL.v8HUHtkH9tfLJH1ɿPL1LAUSH HqLL".11AfL ^"fAVIAUATUHSHHDoTdH%(HD$1HH$D$E1E}1HT${D1HhD$ыD$MLEHAEAHD$dH+%(HD[]A\A]A^ú1褼AątDm@AafDGHAGLfD1ɺL,1H5 $11ML,1ɺ1H5 D$f.HL\,1ɺH58 AWAVAUATUHSHxdH%(HD$h1HHt$$HL$XHHHEFI PARTH9D$uyDt$`H\$XDl$dEtdE1L|$"f.H|$ALE9t8LHH5uLm+1ɺhH5O fE1HD$hdH+%(umHxD[]A\A]A^A_AL!+11WH5 df1ɺZE1L*H5 >@Aff.AUATUSHdH%(H$1HHHHG`THH9LhD%4l"D9eh>1Hھr_WHHM1L xH HHEpDehP1H5 \XZA4fHt{H9L)1ɺ>H5 1!E1H$dH+%(HĨD[]A\A]fDL)1ɺ]L-Y" @L%Y"D-6k"D9mh(HLHD$0HM1L QH HHEpDmhPfD1H葸AąV}@1HھrHj"H1L%MH LL HHEpUhxP1YH^LL(11{AL`S8A<$MIH=KHHDHE1HH DAPH5QLP1IH "E181H1PL~MnH51_AXL'1ɺh1H5{f.HupM1L`1H5AAHEpHA[[rHMup1LAfD8dHM1PL-n1LL8AYHAZ AąL&1ɺp1Ljf.AVAUATIUSHHH@dH%(HD$81Ht$HD$bH|$w7="v1HT$8dH+%(H@[]A\A]A^Ll$ 1HL|$ N+LH|$ N+@iHl$LHHHŀH HHl$?|$ N+IHD$LHHhH HHHl$|$ N+Ht$LHLt$D$D$ LH |$ HuHHL$ HHid ISM CH3D$(HIntel RaH3T$ H uHfg Sig. H9D$0}Ht$HT$H'0HHHH9H@Hl$HLPI1H5uXZMf.K`1L#H52)="HHHxH5HH]H5cIvfDH7HH+H9"LHL_1HtHHt H9L ;S"L1H5eWM1I,$K`L"1ɺ,H5@L"1ɺ,H5@LH\HHHH9H@HIPL}L IR"@Ht[HHtSH9tNH@HIPL9@L!1ɺH52)@HQ"L!1ɺ,H5#@HQ".@Lt!1ɺ,H5-LP!1ɺAH5L,!1ɺIH5zqHt[HHtSH9tNH@HIPH5ALN1*HD$(Y^MHP"HP"JbfAWAAVIS1SUSPENAUISWAPSPACATUHSWAP-SPASHHH8HT$Ht$dH%(HD$(1u=ADDD H;D$EgHL$ HL;H9l$L9l$L9t$HS2SUSPENH9D$HULSUSPENH9D$HV H9D$tLEAR1HT$(dH+%(H8[]A\A]A^A_f.f|$&CEcH|$HtL'f|$&E2tL9t$J|$&D?|$&D@L1ɺ.H51J|$&Dm)qAWAVAUATUSHH $HfdH%(H$1H|$)$HH=H=HtpHHHHtMx.tHHHPL |1L4YH^HHuHU<Hb#L5b#L8L9HL-b#fI]L`L9u dHL9t[HsL\uH]L9u@DHHL9t-HHuL.uHEHUHHBHHL9uHILM9tIzf.L9tUHb#E1LeAL`LH߉HmL9uEL 11H5H$dH+%(uVH[]A\A]A^A_8L 1PHML PH51XZAWAVAUATUSHH $HHt$I$dH%(H$1uHD$HA<$ZH$1LHH|$ 3gH|$ H5H$H(D$Ld$0fDH$PLOHE1ۀ|$0 LHT$/uHcH< tHcL 1HA=vM LwHtAHM1AL 1AWH5;AYAZEDD$E@HcT0tHcDAHcHu uHT$/HcHcH< tM4A.sA~dRHT2HDP vHL$IcǃL(LL-B!1HDLHH9rLLA IA}uHD$HPHX HCLd$(e@LkLH[HH`;VLcMH9rLLEAH[H;tH-C1L 8HH<$Zf.H|$fHD$H$dH+%(HD$HĘ[]A\A]A^A_LH=?u(HT4HDP tHD$Dx \D LH=DtCmukA~dud_HT2HDP tOHD$D8f1|0BD$(HT=HDP tHD$Dx f.LH=u#HT6HDP tHD$DxLH=VHT4HDP HD$DxQ1ɺ1LH5^HL$HA$H$HH9u?1MH-L/ BHrH<$ 8UL1ɺFPHPLL$0H1*Y^LH=YuHT4HDP LH=-NuuHT8HDP LH=u#DHT5HDP tHD$DxLH=HT6HDP HD$DxHcH =!IcH[THL$T$1MH-LJHH<$Iq8L+1ɺNPH9PLL$0{Ld$(L1H5(H<$8d[1LPHH5PLL$015XZHD$Dx8Lj1ɺ;PHxPLL$0HD$DxTHD$LMcLd$(BL$v8$Hh7H *IH/lASHDAPL~QH5PLL$@1nH LH5Eff.AVAUATUSHH $HLG8dH%(H$1G\HHD$t6EAH$dH+%(HİD[]A\A]A^EAAHA L$AAH ,3"HLA 1*xtHt$LAąt C\AEZLt$1ɺLL |$tj 1LC\ HHtH9u3L B"L]H5\1E1LHf.HHt8H9t3LHL1H5 kfDL B"HHt(H9t#LHLx^fL A"fATUSHH $HH 1"HGLG8EA dH%(H$1AAAH$A 1HAH)xBHHAt|H$dH+%(HĠD[]A\fDHHt8H9t3LHL1ɺ1H5E1fL @"E18qI1PHb-L'PH5Z1XZ8ff.@AT1UHSHdH%(H$1HHtuf$UuALd$@1}tutnHL9ufDHH$dH+%(uGH[]A\ÐL1ɺH5n1D1@H(!AVAUATUSHH $HH $H`dH%(H$X 1IH~8HH@ % щD$ L$FbuED$AHu:HE8AHH$X dH+%(H` D[]A\A]A^L$PL%."DL$1DD$ LLH6&Hl$PLHaHHDPRHLLIH1%~H5L'HHCLt$H¾@LHHL$HT$ L1H5;+rAăVD$T$ HH H H%H HH,o8iM1PH L PH5*1XZo@1At5)HAHH H HH H5f.H;AfML&1ɺEH51E1 @HEHtH9uBL <"L1ɺAHH8L1ɺMIDLHf.H1H5+MAVLa1E1sY^@H8U$PMH.IHcH5HDH\E1APLzvSP1H )h8t=M1PHVWE1PL" H5V1_AXML!11UH5-E1nAWAVAUATUSHH $HLD$LF8H $dH%(H$1=*"LD$DAHIHAD;GD9L$H UL=*"LHlL 1AC"Y^!Lt$ LLH5O|LqIHL@LHdHT$H4$L1ÃLnH$dH+%(EH[]A\A]A^A_8$MIH,HjaHDHH W&OAPH5L!tQP1H II1L5H5q1,f.1IALHL IL11۹VH51ɿMrLH51L<@{8$MIHb+H3`HDHH  ~APH5LrQP1qH *HT$LD$DAA*fDI$HtL9u:L 7"AVw1LUH5XZDLHMML[11mH51tfAWAVAUATUHSHHH|$HdH%(H$1F8%D(u FbHT$ HAąLl$ H|$I؉HL4fH=K#)D$0)D$@)D$P)D$`)D$p)$)$)$lHl$AHD$HHD$HD$L-SK#LxL|$(L;|$unfDM?L|$(L;|$UAGMOI_fLGLMrLAqDLLusHHtHxtHD$HHH;D$LHHx1SLFH5XZAH$dH+%(HD[]A\A]A^A_fL^HD$HL S5"L1ɺDH5bt@=a"E1vL1ɺ1H5%7MfHD$@`@uHt$H|$MHD$@` uHt$H|$HT$0LD$($iHT$(BLbHZfLGLLAHpH=AI#DLqHHHxGL )4"NHHHt_HxH5DHHtH52=H{H5'H1uPE1AL1ɺ1H5l:f.H(AdH%(HD$F8%;G t ;t;Gt;Gt;Gt ;Gt;GtE1HD$dH+%(u;DH(@HT$H|$t΋D$H|$E1%;A@AWAVIAUIATIUSHH8dH%(HD$(1HD$ HD$HD$HHžHH H$HL$HT$ HH5HL$H|$L|$ MtwMHL$tLLHL$MHHT$H5H|$u H|$VAEL|$ HmMH<+LD{IL91ɺ1H5^輿MtzA$AHHD$(dH+%(H8D[]A\A]A^A_H|$HHHDS1MWL1H5?XZADIL1E1xH5`IL=1ɺf.IL11H5^E1蹾 @Ht 1H|$AEAEL|$ H=fAWAVAUIATUSHH8dH%(HD$(H"HD$HD$ HWHžH' HjHAąNLt$Ld$ HLLH5m?H|$Ht$ HLLHH5u H|$LLH5HE1uLl$MzLLH5HLLH5HH|$THE1yL f ATI1AWLH5vAUAP1ɼH F=!N"M11ALH5)茼8 HHD$(dH+%(H8D[]A\A]A^A_H|$H|$ 1 3LLHH5HD$AMAąHoD$EDd$ML DML>1E1H5C覻$=M"ML11H5r8 HӻfDMLx1E1H5.H薻HE1腻L fH|$ 1 `@H|$ 11Ipf.H|$ 11E1HIML H55H}DIL k|$AE!H|$uH躺EW3@H|$ 11HI菺E,mAWAVAUI1ATUHSHxH4$=H$L$DD$DL$dH%(HD$h1b HAHD$`LHDHAHHHPS$PD|$0Lt$ ELxH u0HD$hdH+%(+HxD[]A\A]A^A_f.HEA LH)HTLHPS$P H tHEALHLHE1PHS$PϿH APH $HD$,HHDHH9>H=G*"HtHx)HHHL5yHlHOH蒺D$ f.HAąL|$81H5HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`%L|$8D$tH5GLjD$tH55LL1HT$0H5#Hƾ.$LL$8BH(AUL1LXZHD$ AąL$ AAD+ tGAHHHNE1ɺAH1PL1H5@裶XZH 4@1LH5`H1HT$0H5IHν$LL$8H;AULfDHL$`HT$@HH5wtg$LL$8H1AULLl1ɺM1L賵fDHHD$HH|$01 {H|$HIHT$P1H5~HּHT$X1HH5NHM1t$PLL1t$HWt$pt$pt$XLL$hD\$DH0Et!LH5LL$qLL$D$ $u&HL$0LL1H={ދLL$8HD$M=v"L o"uULY1ɺ1H5>E1虱H$hdH+%(HxD[]A\A]A^A_DIH\$`HJ8H<$IHHHLd`L$ALdHL$LL$HIpHl$ L@HzH LH5"H1MAƃL)(l8起GI1PHLPH5'1舰XZ1ɺE1L H5^fL1ɺ1H5/f.H1H5IUL?1E1Y^D蓹E18ٶI1PH L:PH5K1謯_AXLD$ELD$8H$t>耶I1ɺ(PHLPH51SAYAZE1HT$HLL "tHL$LLH9^LbAtFLHIHH$8tI1ɺ4PHSL(P_La1ɺ01H5F褮ff.@AU411ATUHHdH%(H$1ILHHt|}@1LDE1䃼$xAċE@ED~1EDt)H$dH+%(HİD]A\A]fHXfDALi11WH5謭f.K8蔴HUHH9L 7"H (H5FA9HEL "H9tLJHZE1PHLYPH51QH fHEHtH9uzL "1LEH5s׬Ls11cH5 趬LJH ]A9:H $F?LHfL 9"H FH#A9HDɶfAVAUATUSHH $HH "AIIHA AHվdH%(H$1A@AA Hg1LX`LIHELDHPLH.uAytۀx.uAy.u AytdHI1SL5L)LKAYAZL_1ML51ɺ^L1H$dH+%(H[]A\A]A^fDAymf1LHJHDLL5QͶuiHL1IS1ɺ\L脪_AXbIٹ5L,1H5I1-fL58-1LMPYHPLh1Y^TDL5@L51ɺR1LtLĩxc8謰YM1PHLPL1胩XZE"8tML)>ASI1LS<H5.[1]DH$LWjDLLHAWfAVIAUI1ATMUSHH(H $H|$ >dH%(H$1)D$HH蘯`L|$ǺD$ L踫|$ H Hc1LLH5'LD,蝪TH-{LH2HH$LH(:H<$AMtMH-GLHHALLH'H5ULD+8tI1PH?BLMPH51G_AXILx1ɺOfIL01ɺG1H5<1H$dH+%(}H([]A\A]A^A_ÐIL1ɺUDI1ɺaLH5薦H$f.I1ɺpLH5^A$UI1ɺ[LH5a&H$9f.I1ɺvLzH5)A$H|1IATLq1ɿH5讥XZA$fH1H5ILt$Lg1AVqAY^ѯAWAVAUATUSHH $H8dH%(H$(1HH=IjH?IL$ fDL舳IHA.tIoHH uE1۹LHLغHULL ,LL$1LD$,HH|$0D$(H|$IHLLAZA[HT$Ht$L $a9ML $tLL襮L $HL $&IHAoGT$L $@ oMH0D$ tHH H H%H IC$ |$ AL$Lv11t$M麼AVH5sH;_AXL$HCILICLL[رIHP@LPMHLDHE1H9tHAH9uH11AVLH5բXZH$(dH+%(H8[]A\A]A^A_DI{A1ҹLL$蹭L$H|$ AƃfHt$1ҹL$ItL$HAƃ@f.˫81H5AL PHpPLG1Y^GSB1ff.ATUSHH $HL%XHLdH%(H$1HHIHL%1ɿ1ILL?Hu#H$dH+%(}H[]A\軪8tI1PHӽLPL:1֠XZfHML{1SH51觠Hl f.AUATUSHH $HL-&HLdH%(H$1HIHIHL-`I11LL Hﺀ1Dž藡AH$dH+%(HD[]A\A]ÐA$t5HMLP1SH5E1vH또ۣSLcE1AUAH5{1>_AX]fDۨH1LIL E1P1Y^!f.蛨8I1PH9LPL1軞XZff.@AWAVAUATUSHH $H>H-fLf8H|$LIHH$H$ML$HdH%(H$1D$<D$8)$HHL}DEE AH1DD L$ALL$l$()AÅ>H $H1HcD$1H)HLD\$A1A,HHD$HHH9HHLt$@1DD$,HLD\$ D\$ LcD$,x-HHqH9hH@HML1PD$8(PD$,PHt$81賜H 1L諣AƅPu)ŅHcLDyHHHt H9L "R1ɿ1AUHt$(L6 AYDAZĝ@DAt^HI AWLH5 1ɛXZ1H$dH+%(H[]A\A]A^A_@AWLUA 1H5i]1A\fHt$H HH9LHHHH9LH=s,"D\$ LH1ɺt$D$8PD$,PHHHD$81͚D\$@H E1DhfL i "D$(LH5PD$PfH9 "@H ) ",@HE1HD$f.D AHL$H9HH9wLHAT1LAUHt$(.ݙA[1[Ic1LLHH)L.D@|38|M1ɺBPHG4LPHt$(1Q_AX@Ht H9tHXH "蔝HLlAD$0H57PD$$PS1H DHt[H9tVHX=HLATA.AUSHt$8fLHUL I "@H9 "L ) "M@}XM1ɺ9PH#3LPfL$@1H$LHT$8HHHt$H9t9HXGHL?ATAct$SL l"H`" fATUSHH $HfL%HdH%(H$1HH$H$I)$HLHL%AI11L tLHH IمtA1L1ɺ{L輔1H$dH+%(ufHĠ[]A\1ɺxLL}fDHp1MSL1ɿH5GX1Z謞ff.AWAVAUATUSHH $HH $HfHkH4$IH$IdH%(H$!1D$P)$)$)D$0)D$@HH$HH$H H|$L1ɺpH|$H5G7HD$H?L|$`H\$0iD$LT$M11ULH5@t$I<$AYAZLT$ID$M"IBLMT$HT$@LBH fAofAoWH) )S诗H L$H1SLLL L$0H$ў1LHHIHLLD$<D$8XZHT$(Ht$,/H$Ht$ tHLiHIHfofocT$,X `0D$( tHH H H%H IB$ FIzA1ҹLLT$薜LT$H $AƂf1ҹHLT$IULT$HAƂ@L1ɺ@H5'1E1H$!dH+%(Hĸ!D[]A\A]A^A_fDI$E1I9t@HAI9uHL11t$H5Ae_AXH|$踛n8D1ɺH5lPHLPLL$(1Y^,fDL1ɺ1H5'I<$HI9tHGHCHȔHHI9uH|$AąSE18虖1LPHH5PLL$(1jXZL1ɺH5|AUAUL1SLL$H5PA[[!L1ɺ1H5'H K3$H5"H=3s.ff.ATUSHH $HL%HLdH%(H$1HHIHL%1ɿ1ILL/Hu#H$dH+%(}H[]A\諗8tI1PHêLPL*1ƍXZfHMLk1SH5ٴ1藍Hlf.AWfAVAUATUSHhdH%(H$X1HO`@HDŽ$()$@)$0H9u)H$XdH+%(eHh[]A\A]A^A_H!HHtHX1H1D$$|$$Ht$TG/H|$XLcL5uHt$X1L|$pH~HHt$0HHHdžH)HLHt$xHD$pD$$DŽ$0HDŽ$$D$TDŽ$$DŽ$Ƅ$HD$0H$PL$@HT$HoHhH@x) $H$(L)$@D8GHH9uH$(L$0HD$(8HI9uH|$`LL1ɺ1H57CHD$8HD$GL1ɺ1H5HD$8HD$0HD$@H|$8ޏH|$0ԏH|$ʏ|$$q@IL11H5蔊fHt$`1H~HHHdžHH)HLHt$8HD$pD$$Ht$xDŽ$0$HH$HDŽ$DŽ$Ƅ$uHt$8~PH|$hL[L_1ɺ1H5袉HD$@;H1ɺSDLH5S1bAZA[HD$8HD$0HD$VHT$h1HzHHT$HHHǂH)HLHT$xHD$pD$$DŽ$0DŽ$$HH$D$TDŽ$$Ƅ$菎$Hl$@Hc $HD$Hp@H\$(fA)$HA)E<b<,<HD$D$ 1o\)$@H$1 fDHuuI9uHT$HLfDHH98tH|$@L葐L$  $$=$D$ 1<tF1҉D$ t@f.E1)$H$DŽ$uuidf$)$)$)$)$)$)$)$@AHc1A)GL=HLIcH^A9~qAGt AGu'AHc1A)HHsIcA9~8IIuHD$@HƄ$HH@HL$@HHt;H9t6H@H1ɺVMPLTH51)ZYafH!HD$D$ 1HDH$(HD$D$ HTHD H$0H$8@HD$(HI98tHt$(H|$@Ϗf.Ht$(H賏fDLH-H1ɺSDLH51*AXAYHD$8HD$'躎H1SDH5ާL1^_Lv1ɺH5軄HD$ATIUH-S1LHt]HuLH=AEt)1MSLH55.1[]A\HcHH[]A\Dff.@HUH51HStnH5bH@AEtRH5;H$AEt6H5;HAEtH5;H]1DATUSHGauHoHHKPHGv ǂG1LBI1HHlLlxPHSPHGDGL[]A\fHHH9H@pHhHa@HCPHE1LLU1H5caXZff.fAWAVAUATUSL$HH $L9uHhfH|$H˹IH$`!H$HdH%(H$Xa1)$P!HHL5|5H=wLL|$02LN1ɺHH$P!H$H@HIHtZI}HuI}?/uIE8/uL莆xH$H9D$0uIuH<$1ҹWH\Hց$P!PH<$ HH4$H$PH$PHHH<$HȹHH$PfHP!H9tD p uHƄ P!\HƄ4P!0pƄ4P!4Ƅ P!0H9uDID$PIT$H1HHD$HxIHH$PH !1HH|$L1ɺ?LH=迌HHyH$P1E1L|$ HD$L$PQfDHL Ho$PQ/uL$PA1MLHL$LH5PفuLHىuHt$H<$ljH|$LD$L$證L$T$@Ƅu @at @uLDAUh1Lt$LL$ H5nA~XZL`H1t$I1LW$H5(~_AXtL1ɺ<H51E1X~H$XadH+%(HhaD[]A\A]A^A_@H耉ugEtL1rH5}IL1E1H5k}jƄ$O1-LQ1ɺo1H5=}st$1H5!1t$bL LL$ a}Y^L1ɺB貇fAWAVAUATUSHH $HH $HfL$L|$ HIHӾLIH;$dH%(H$ 1)D$ NLj1ɺIEPMMHL$HLH0L1HhL1ɺkH#HKHD$0H^AHD$8HWHD$@HTH\$HHD$PLt$XMtHBL|$hAHD$`8 t#APH=+AHcHKH|0IcHL0ƒ@tAH= IcH|0~ tAH=IcH|0D9 At1H<$H5DD$ DD$ uAH=IcH|0AAL$McJD0HH}Lj$H L-DLL4$ILAT=L "LPP11zH HHT$Ht$0AąXIL= "LAH11AVjzXZH$ dH+%(eH D[]A\A]A^A_@AH5}IcHt0 ~fL1ɺfH51E1yH( DD$ L$HL  1&DD$ xA@H=8 HH5H|0A@A@HHt0IcL|0D9 fDL1L(yLIH=脂HuHPH"WAWAVAUATUSHH $HH $HLNHdH%(H$ HFPIMIIHվHHL1HhH$HL1ɺH"HHD$ HݡHD$(H8HD$0H5HD$@8 H\$HHl$8tH5'HUHt$PHT$X@tH5HcHt x tH5HcHt 9 rt.H5 LT$T$uH=HcH| HcHD H$HI|$M$LA$H A$$jE$H$IAU=T";L-PL1L1vH LHT$Ht$ AąDIL="LݷAH11SnvXZH$ dH+%(YH D[]A\A]A^A_ÃH=HcH| mH( H$HdH|$  1iH|$CH5<8 9 HHt C@HH5#Ht HcH| 6@L1LpuLHL1ɺ*fH5؛1E1*uDH=~HuH`H"gATUSGHv LJG1LB4fHkLZxGDGL[]A\AL11E1H5PNtf.fF$G$FPGPf.HGH@HGH@H ff.@HHHRH9t%H HH9tHPH9J@u1ff.fHFHWE1HH9 t DDHHH9JuH@E1H9BADHGH@ATSHHHVHt HHtH9u@LD$HLhI} yAƅH-1ɺ1L7HjpD\$E|HAuHL 1LH10pIEPAY1AZHLL1pH1ML1ɺoHIwH DE H@HPXHCPH8 H1IL1oHIw1Ht8tH@HP`HCPH8Z 1ɺHIL1:oL1ɺH1AofL$H{ @LAƅ !HL$`HE1E1j1HLjj謠H T$`HC`L-.H2D$LDH-yL1ɺH1_n1ҾL;D$HCPL!1HHsH1LhnA^XHCPL1HL1mM1ɺLH1mH1ML`1ɺmHIwHt DEHHCPH8q LMGIMLLD$]rLD$LhLL)IHtLLH3{IHLH1AT1lD^_Ek11LHLE1lHHL$lIGxH LxI9tcL$IpEuEHHHDIGpH1HLgLHHR1kXIGxZLxI9uL|$HC`E1HH$HL$ H%LHT$P1HD$ D$AŅLL;T${1ɺHILLT$LHH13kLT$1HLIH@LHH1kD$(HK`D$H  DD$E|$dd Dm!EtPH{H\HD…t$R1HL APLq@1pjY^fDDL$h11L(IHFjMHsh@L̫1ɺ1H5jH$dH+%(|HD[]A\A]A^A_H@HPXQHC`'H8Cd V LKHL1H1isLHC`E1MH$ E1fDHAŅ} HK`H0H- @} CD$(D$D$ D$fDIEPL1HAuHLhvDD$L-DD$tL-%HLDLKHL1H1WhEfHt$ƦAƅt'|$1HC^fDL1ɺ1H^,fDt$H5MH]RUDO HEuH]RfDLԕ11H5x|MH]sRUDO HEuH]VRfDL̕1)H5j,MH]#RUDO HEuH}RH]QDL1LH5LfUDO HEuH]QfDL1DH5LH]QUDO HEuH]fQfDL1/H5Lğ1WH5ʟ\>f.USHHD /"bdEuH[]f.1HHYt̃t]yHHH9LHLA1uH5j=Kd1@f.DHAAHH9Hp1H- jL5H==_AXHHH9LHlH1L<BfDL ! @H1j5!H-oLH<Y^kH HHHHHt>H9t9LJQnLHP1O<XZL !)L !x{USHH "bdu H[]DEtTAH I<ILۈ1H5;H[]@fHHH9LHL(1ɺ/1H58f;UHH5_M=HH5H5^HEH5^H;BHHuUHH9LJLX1UH5:Kd1L y!-@HH5է HHHtFH9tALJQWL PH5;1g:XZL !e@L !AUATAUHSHHHdH%(HD$1bdHH$Otu+HD$dH+%(HD[]A\A]fHHtHH9tCLHL-L1!L9KdCbt H<$HuE1L 9!HHH9tDHPHtH;z8tHH9u|HHH9HrH$L   HtH8HH9LOHLֆ1VLQ1R+8D%N"H E$HlvmdevicH9!tDL߆1ɺ/1Ly8"oH5#!;L !qf=ѻ!esu=ʻ!BATUSHHHz8bd%Dd$E 9tFE9t?;U CbA~EHK8 % 1Au)%9Et0Hht/=![]A\@fH؈tċH HHHHHt H9@L !Q%LԅPH517XZKd1[]A\fDQC8%.Hf:fDH@EHL`H5GL8HC8%;E t/LH5/l8HHH5F`@HHtH9u1L !L1#H56LHf.LJLw1ɺH5eX5=LZw1ɺ1H5?X5ATSHH(Lfz8dH%(HD$1bdD$ >tA4$HT$ HAątRHt$HLH^!AH9D$HD$dH+%(7H(D[A\fDCdL$ €t HSdHH9LHLn1<H54fHHH9LHLP1H5aC4KdE1/@HHtH9ucL ܥ!HH"PL1H5 3XZL !m@L !@LH%>DSHH $H1dH%(H$1IgdHLHLH?<$HD$tB$HpH9$H$dH+%(H[f|$MuwHHH9LHL֔/*DHHtH9usL |!Ĺ'1H5Β2Kd@1[D=AHHtH9u;L $!Lk6릐LHf.L !L@LH<DIHAx Wf.HHw 6HATL%1 ULLSDOHE1CH{4>Ht"SH1H<2Hkc[]A\1LL溃G11ATSHHGP;Ww/HSA CHSCHD[A\D#Aąt CL|r1ɺ1H50ff.fAVIAUIATIUHSHHdH%(HD$15A1EHc](H|$Hھ 1HHuD.8H}LL5Mt7U(ЅXIHu 4~HuL7Hu 4HT$dH+%(uH[]A\A]A^fD1H|$`:ATIкUHH(udH%(HD$1I)H}o$HAHHD$3x EP;Uv7HgAąt@AHD$dH+%(uxH(D]A\EHU Aąt0ALp1ɺ1H5.DLdp1ɺ1H5y.x 9ff.fATHFADHxDgt DA\ALo11ɺbH5<.DA\fDATSH>tAHD[A\HFPH~ HooNQAąuHCPHL6}H5LsH1-XZAVHHAUATULE1SHLIC LkHLPAAXAYIHu Ht}t [L]A\A]A^ÐImHHmIŋC )HHEH$H9HLHRL5211LLp|,HEY^HH9LH11Lw|L,MIMME{t!!eA1ELg1ɺH5;H4%DUvHHb!L$H8F0L$vHR! L$H0)t$EAyH-uAnH-`H}{H}ul1Lf2H5gg$!WH!H=RH41nS*.ff.AWAVA(AUATAUSHH=H8HD$(HL|$( L贆HHEL8fE H@H=ԆA@D`&IHHE11HuH@AHts8tLWsnH-|1H'#L蟅Ld1ɺ1H#H|$(E1uH8L[]A\A]A^A_DHLHD$ H,H}DHEHHmAOH LcLKAH)$)D$uTIrL{1H5{E1H$(dH+%(H0[]A\A]A^@Ll$ IHLEx/HH$HHtHII)IwILHLHBD4 H$HLL]H,$D$ DI}Lg fAVAUATUHH $HfdH%(H$1L$IHH$IHLHnD$HD$oxe$Au-H$dH+%(uhHD]A\A]A^Ht$ LxHHLL4W1ɺ1H5DyE1tff.fAWIAVAAUAATEUHSHH(HtHx*I(fH@I?wHHt_fH@I(}AuHD[]A\A]A^A_HHCHtKDsDkD#f.Lx11ILJ(H5uE1n돃9E1LeH5uIg@AVAUAATIUHSH0HtHxH0fH@H}vHHtZfH@AH0A<$u[D]A\A]A^LHCHtKD+D[]A\A]A^1E1HDž0LwH5t^땃E1LeH5t9m@AUIATIUSHHdH%(HD$81HGHpH$HD$Ht$ HD$HHD$(HGD$ P`HHHHH@H9HALE1E1LHIHtTHLI9t fHSLHHI9uHD$8dH+%(uuHHL[]A\A]LS1ɺI1H5s'HEHE1H@Ph@C1E1LcH5Ws{Off.@AWIAVAUATUSH8L$dH%(HD$(1rHHIHIH9u!`EAąpHH9tAH{LH#G`tۋL$MLc1ɺ1H5rIIH91fDHPHHHH9utdHM1E1Q)LdH5rXZL7GHD$(dH+%(H8D[]A\A]A^A_ÐIIhHt$D$HD$ HD$HGP`LbHH LI~sHMIIHD$L9uO!ImIFELHAdžHxHGPEAąMmI9ImHE`@atHu@HHH@|uI~(BrHfH@ @ImIHhIHL$HPIHHILP1ɺ"1H5=p+f.H-pLEs1aHL5P1ɺ1HE1y@HE@HtoHHtgH9tbLJH-oLa1fH/DL1`H5to1E1]@L !LO1ɺ1H55oE1 (LGAąLDAąAIEH@@HHHH9LJL`1H5n@ IdžL`H5yn1E1 bLN1ɺ1H5Nn 1ɺr1H5a]DAL!>11qH56]dfL=1ɺu1H5]?Xf.L=1ɺv1H5\(uDAVAUATUSHH $HLv`dH%(H$1IHHHLkLH5pH1Aą%S(H5`H1Aą>HCHHH(H`H1H5`Aą:ALHAą2H H; HHt :yHH)H57`H1AąHHH5`H1AąL-<1ɺ1H5B[p'fDL<1ɺ1H5[GH$dH+%(HD[]A\A]A^DAL;11H5ZfHXvAąLy;1ɺ1H5ZpH*_H1H&AąH5_H1AąAH5_H1bAąwCPhHCXHt HPH5^H1*AądH5^H1AąAfL|:1ɺ1H5Ysf.HCHiH@H5A\HHt8u-HH;?2H5cII5 f.L91ɺ1H5Xf.L91ɺ1H5Xf.Ll91ɺ1H5Xcf.L<91ɺ1H5QX3f.H5\H1oAąkL81ɺ1H5X3fDL81ɺ1H5WfL81ɺ1H5Wf.HU AąCP1҃H5-\H1Aą0L81ɺ1H5WGL71ɺ1H5V!L71ɺ1H5VL71ɺ1H5V1HH38HT5ѸʸÐAWAVAUATUSHH $HH $H(dH%(H$ 1IH5:[IUAG(IH\$9OAG(ML9Hl$L5[I\$ HHdHL蘱$LAW $1LL AG(1HLfo a_H5XfAnG(f89fA~G(HC@H_HHSH9JHRHH$JH$H=Hu%6fDHȃ\t2HHH@0t<"u\HA1HH5YLmLAW uIUHC@twHtrHP0HtiBft_HfwVLBHH HtBML$t91H5wYLjL$1LH5mYLJHLHH;H1H.YLHwH1H5YLAHYLHH1*HHtHAG(PAW(H21LHaM$$L9d$:AG(PAW(1HL*AHc!@LXn$Ly31ɺ*f.LGlH5kRAG(,1H5WLIH1HWLH$L21ɺ4$L21ɺH5Q1D $H$ dH+%(H( D[]A\A]A^A_É$L21ɺ Lu21ɺ1H5QE1뛉$LL21ɺn$L621ɺX$L 21ɺBLF1H5QME1-$L11ɺ$L11ɺ$L11ɺ'$L11ɺ,$L11ɺ/$Lp11ɺ.$LZ11ɺ8|$LD11ɺ"f$L.11ɺ#PLElH5*P]AG()H$L01ɺ<$L01ɺ3AWAVAUATUSHH $HXHn`dH%(H$H1IHW sHSHH57UL1AŅSAG(fo nYH{ L$@LfAnG(f89fA~G(T^AŅiLH5-L1eAŅZHLAŅKHH;OHHH HtH5bSL1AŅCtk  } 1҃ H5ESL1AŅPL/1ɺ1H51N_)DAL.11H5N4H$HdH+%( HXD[]A\A]A^A_L.1ɺ1H5MDLt.1ɺ1H5MDHCPHHt:u-HHM?DH5W0HH5DL-1ɺ1H5 M7fHCXHt HPH5QL1"AŅSxtGH5RL1AŅu/L{-1ɺ1H5LfS|xCH5eRL1AŅu+L-1ɺ1H54Lb)DHH1HL$H9tfDHH9uH5RL1,AŅLAW AŅHL% H9l$kHD$@H\$(L5@Z HD$ fHD$(D$@E1HD$8H@P\$ HD$HEL``HD$ HD$0AEIH@IHH@tItHHHt$81H|$0H2Q.BuL+1ɺFH-J1HL+1ɺ1HE1L+1ɺ1H5Jf.L(fAŅLI+1ɺ1H5^JSH5FPL1AŅL+1ɺ1H5JJL*1ɺ1H5I$L*1ɺ1H5IHHY+HTCT$ 1H5PLAG(1Lfo ySH5OfAnG(f89fA~G(U AHD$M$HwOLH1LAW M(t*HD$HIOLH1HHEHL$ H5.OLHP(1HH;SHEH@ H@HtLHЅAG(PAW(|L%s 1LL HmH9l$AG(PAW(mLL1kAŅADH-HL(1ɺKHfALH5|ML(AŅHH5iML1AŅLf(1ɺ1H5{GpL@(1ɺHeH-RGL&(1ɺLHoTHMH5 ML1AŅL'1ɺ1H5F&L'1ɺ1H5FH-FL'1ɺSHLp'1ɺ1H5FzH-oFLC'1ɺNHqLaH-8FL '1ɺVHU:L&1ɺ1H5F/Lf;lH5EAG(UL7;lH5EAG(dH-ELa&1ɺPHH-fEL:&1ɺZHhH-?EL&1ɺ]H\A1\L%1ɺ1H5E/,"wAWAVAUATUH(SHHxHt$HT$dH%(HD$h1DHLI@H@H@ HEHHD$L91Lt$8Ld$@DM?HL;|$LmIGI}LLHD$8ILLHɕuL%CL$1ɺLL$1ɺL1E1LeMt"IT$At$LILHEHD$hdH+%(. HxD[]A\A]A^A_fDE0EHD$L%HHLH1sAŅHE(fo MHHt$fnE(f89f~E(0AŅHU AŅ4Ht$HwAŅHU AŅHD$LL;I1H5IHE(HL$9O‰E(HI9tqDH{`tHsHgAHI9uHD$HI9t/fDH{`uHsH'nHI9u׋E(PU(L-1HLqL%AL"1ɺ)LLt"1ɺDHD$HT$HH8AŅL<"1ɺ1H5QAf.L "1ɺ1H5!AOgf.L!1ɺ1H5@7f.L!1ɺ1H5@f.L|!1ɺ1H5@L%{@1ɺ1HEL>!LHU AŅHL$L-@HHD$(H;1H5FHRjE(HL$9O‰E(HH9L$(Hl$IHD$0IGE1H@LhpHXpHD$ LI9)HE8uH@HxHMtLt$0HmH9uMI~H|$0IHHD$8Hl$0IE0uf.D$]LHI.11%1H-a3Lo&H|$<6Aą&HLj8hMH$IH4QHhAPL{HDSE1P1"H m@ATUSHHH(DEHxHD`!EAąu8L\1ɺ|1H5 0f.HH(Hxu8C(HL1H-/PL$&H12HZYHpHxHHHHH(HHpD@AąHK`AD[]A\DHK`1A1L"%vH5/D[]A\@t1E1LL%H5.^@L1ɺ1H;afDL1ɺ1HE16ff.ATUHH4^!u.^!%^!~$AE`t)HD]A\ AE`uHHtH5tHaA)HD]A\ff.ATUSHH $HHdH%(H$1H0HHHHG`LI1H\$LW%HH}Lb"b"|IH@(9E(b"AD$`RLE`u,HHH5Hu$L 1ɺH5,DH$dH+%(H[]A\D@u1L"1ɺxH54,HE@fHEH1ɺL"H5+H0LH1vLVfD1HNL 1ɺH5+7fI$HtH5a1LvL 1ɺH5B+R@`"KDHHI3$I3$H HHI3$I3$H L]`"Gf.AW1IH51AVIAUATUSHH7_AF(9OAF(AOLt@1L--IL$@ILtV 9wAF(PAV(yH5-L1AąA@HBHpHlL/…~AGLL H50L9IMDJD H1AAąhAOLPDIDAL PS1H5(E1XZHD[]A\A]A^A_IGHr@Fd:IH JD H@dL,HPHL9HNHH5/MD1kAą*L1ɺ1H5(/If.LȑL9JHVHH5c/MD1AąL1ɺ1H5'ALY11kH5n'HVHLH5.9H (ID1{Aą:L1ɺ1H5'?YLvlH5&AF(XIBALPrSL1ɺx1H5&E1LZ1ɺz1H5o&L41ɺ1H5I&w1E1L4H5&KefDAWAVL5a3 AUATUHSH(H|$t$ tLz4 Hs2 IDIHD$EfD|$ I~HtAME1fDA#EtL}L$AD$IH@M,I}Hu˃|$ L}H5;-LHL$HmHEf1L,H5,H(1[]A\A]A^A_fL}H5,LmuII~Ht]fDIUH T$|$ eH5,L-HII~H0L}1ML!,H5+\1HD$HL$H H([]A\A]A^A_HHtHHt H9tHBfH4!HGAWAVAHAUATUSH(LjdH%(HD$1HG@D$H$HH9HIIuIDHH9HPH9r@uAT$DIHL$LDHH~E<H}(IU(HIu AM0E4HUHƒI}MPAD$ H ,EHu@E2YH0L&I}(H3,Hu@HM0LS2HU(IEuHVH5b#Q R[PLT$01ARLH0AD$ E<IuI}EH 01AUL=]LL'LHs_LAXH9Aą^|$ 5t|8HʼnHsL=AąHs MCL1L&xHsLY^2A.f.L-1%H5},H$ dH+%(H( D[]A\A]A^A_ù1E1L,H5*ٺBD$LDL\1ɺA1L裺E1oA.Lt$fD\$ f1ML,3L]LtH8>ML$IHHSHDH5APLjfSP1H DLKL-L%aSILH $LA9:IEHAPL fQP1蔹H L}xLKLe<A9MDHPHPATL1=H @8$EMLPL 1sXZaL%HnR8HL=ͿML$ILARHEH #AP*QLeP1荸|$,H 0}p$,LdIDAQMPHPSATD%kI!USHZF(LEt^H1ɺTPH-ML*1HH{輻AXAYH{AD[]A\fH \PH-LV*1H蔷YLK3 ]H1L"mH{H3^_w8KLKH_PL 13$XDZ[]A\f.LKHL7"1 W8LKHIHHSPA9H HDHXE1APL cQP1葶H D[]A\DATSH8HXIHt0ooKHoS P HC0ID$0HL[A\Lk!1H5] f.HLVM2 001HfAWAVAUATUSHH $HHjdH%(H$1HcAąt8Lm/L蛻LHL`MDLLu:AH$dH+%(dHD[]A\A]A^A_LM)5HXJ#H=ILLLL-@蔶K<&HLH 1AVLMLL軴D%E!LEt,L 1ɺ1L菴 f.H}L8`L/LP1AVLM9XLZ?f.HM1AWE1H5CL&Y^T@SHHZdH%(H$1H{?u\H;?u,H$dH+%(HĠ[fH踸H;x<H;H萸xH{t83LKHH IHLA9HDHAPLh_QP1H54H 16{8ĹL HrH IH9LA9HDHAPL^QPATUSHn HLe (}H} Ht*HL9t"HGHCH@HHI9uH}0Le(Le Le0Ht+HL9t#HGHCHHHL9uLe8Le0[]A\AWfIAVAUATIUHSHHZpLrhdH%(H$x1D$`D$0)D$@)D$P)D$)D$ Ht8H5Hܴu o)\$ocT$)d$ 7fDHHHo)|$o)|$ oMoUHD$HD)L$@)T$PLl$@HM@ILIt$ jLPL]t^Lh_H1ɺ~HLH@XHHD$HLc`H HCpM{} Co] oe0)\$@)d$PE1H,$DM LLIHLhIUIEIMH H HSH1HGH9>LNRL # PH571HC`EL$ HsIMMEHxpIUAH$ZYlH,$H{0Lk0LH'Mu;Hu1I9t,HHHL9uHBHRH H HHL'L9t$HGID$L 'LM$$L9uLL I I {H<H{0L`LpHS8LL(Lk HPHS8HH{ HC8HaMu&L9t!H@HHI9uHBH HL'I9t#fDHGID$L gLM$$I9uL I ƱH~H{ L`H@CHS(L(LkL|$pE1HPHS(HLcHC(H$M9H$LIHL9L>fLH)D$pHCHPH$C t DŽ$HpH8LM#u1ɺQ$H-LHdL11 H5CL11H&D $H$xdH+%(#HĈD[]A\A]A^A_fDomou)l$@)t$PL !@TLH5蔬L011 H5sL1ɺH51RE1(f.omou)l$@)t$PH$H}pDc|HtH5MnADEtDH}@Ht$C|CxALH5蝫L911 H5|L1ɺfLk8Lk0?Lk(Lk 1ɺ$LH5j D $$L11H5B D $SN\ff.t=ATUSHHv@Ht#HIlHHxxvpE|t[]A\øf.HC@HtHHt H9L !L1ɺ1H5 .A$@HC@HtHHt H9L !Lh1ɺ1H5/ ީA$AHC@Ht HHtH9uZL s!1LmH5 菩1LJ(LJhLJf.AWL1ɿAVIֺ$AUATL%n USHHLndH%(H$1HFLMHD$P1XZMMH-%RMIF@HtHHt H91Hj!HMHPL1ɺ1腨M^_Mu8H|$IF@Ht=IF`1Ҿ2HxuMIF@HtHHt H9H!H1ɺ HPLX1IIA_YH9RH,LLPI1ɺ<1輧IA[A]H9 HKhI~@L)L9LKpIHMH1IIIHt&ILH)L)L9 HIH)IMHtHHt H9o H!HM_LPL1Q1UH S|ACxAHIIHDH9HSHIfHBHBIHD$II @IN@HtH1Ht H9~L !RL5P1LX1ZH$dH+%(n HĘ[]A\A]A^A_IF`1Ҿ1Hx܄D,McM\MH-NMIF`1Ҿ/H-NHx蚄LHHII HLD11MM>i AM9ZI~@IF`1Ҿ.HxrIF`1Ҿ0Hxr7MML&1H1M赤MfMHPHHDH9;H@HL1LP1sUHCh_AXH`HK`HSpHt H4H9H9H)H9HIHDI@HtHHt H9ZL !L,H1L軣1@LNIH(HHH9H@HILY1PfL1RAYAZdfH!@IF@HHHH9LJLSz*@A#@A@A11LeHM譢I~@M|MIF@HtHHt H9L '!LBMLn1L*10IIF`IV@H5H@HI+1҅ILcMIF`M~@HH H@LHHD$8HD$8IHD$H|$,HHL$8MIHL9LHQ11L RH5eRA[XHD$8H HD$ 8LT$@H|$LH MHHLT$(D$8MLT$(HIHL9LHARL1ɿH51LT$0R諠HT$(H|$81H5G AYAZDT$8EDT$(pL" LD$H|$LLH |D$8DT$(L 0T$8MIHL9}LHDT$L 11RH5ASHcD$H_AXDT$A yH 8DHcH>IF`IV@H5v H@H(IHtiL1IHt\IF@HHHH9HBPML1AWH1M0MAZA[DIF`IV@H5 H@HA(IHL1IHIF@HHH H9HBPML1AWH1蛞AXAYMIF@HHHH9HZIF`HH@DL$Hxj AHIF`H@D$DLHx$AHIHt2DY^ISL6UH@LJ(LHH1! @H!!@L !BMIHL9LHH1ARH5LY^HD$ HD$ HT$ H M<IH0L9'LHH11RLH5蝜XZHL$ HL1HHyIF@HHHH9HBPL|$(M11ɺHAWLc.A]MXMHHD$ HD$ HHD$ HD$ fL !@L !_@H !n@Hy !@Hi !N@L Y !L M !{L A !RI7ff.GGvDSHH8HtJH;[ff.fUHHXHtzH}pH]AWAVAUATIUHSHH8LvhdH%(HD$(1~ D$ oF oN0)$)L$L9utQE1ID LL@wIHtH}D L$wHAtmADHs@HHo\HfHH`HPhI9H¨Hp LmAąI LLvE1HtH@HtLhI LeH{hI9tMtAD$Ht HGH@PhLchHHu\tbAHHLHHD$(dH+%(mH8D[]A\A]A^A_f.AuƋAtH+1L)HHH Hoo^)$)\$*fHC@HtHHt H9L _ !1E1LH5x#HELH8AvHHsH}E LQy@HI(HtHHtwH9trLHH 1QLH53_1AXLH5$1E1ΗyfLJL i !HEH$DLHxjKHS@Y^HtHH Ht@H9t;LIHE1PL1H5t#XZ@L !L1ɺ1H58L~1ɺ:f.AWHAVAAUATUSHHL~hDL$(dH%(H$1Ҁ~ D$PeoN oV0)L$0)T$@dHI LLHt$0 MH Ht$HD$HI H HD$HHD$ HH H$rHt>o+osHT$`1H{hA Ƅ$)l$`)t$pژA…?ڛAÅusH EH|$H5L;,$HC@HHHH9HBHA PL|fM틓E ȅH jHHHH HDLEL;,$H$L9HL)I9fL$$M)LHC@HtHHt H9L P!D$H 1WLaH5Q1ATcD\$ H AMBL9H{@LD$I9IF1HI覲D$*HC`HD$LppHChH8IHfH@@8@@ @0HChH8H fH@0t$(L@@ IVIGIWHS@AG HLhL`H@H@0@ qo;H{hAHT$` LƄ$)|$`o{)|$p.tD$soof)\$0)d$@HH(HC@Ht HHtH9ujH!QAL PH51誒XE1ZH$dH+%(,HĘD[]A\A]A^A_fHBf.H pHt$1ɺ LD\$ AnD\$ H xHtH@HtLhH oLhHD$HIH c @Ht$ LD$,nD\$,Ht H@HH|$L,$H t L+l$H H5L;,$ IBH9rIcH1HHH)HHEL|$J<&MH1LD$ II HMtMJL9J<&L9MI)EmLt$K6L9I)1J<&HIHt MI)J<&I9AH H|$HLIE2H9!$@HC@HHHH9HBD$HAPL 1H5kAYAZD$hDH5H@L$$M)H|$1LAH1Ht$HIH$LH99H)LL9@II L9vSMI)EdLIfO 'I)JL9SM1MHt$H#J<&EILhH QHHHLI[LJWHC@HHHH9LJAVH51AU L 蒎YE1^LIDH)!@HH5MPL}1 Ht$/_AXH4$L`ML :@H50L 1H4$ȍH4$L`1ɺ 1認E1fH5L1H4$xLpH4$I͗MH|$E1eH8fAdH%(HD$(1D$ )$)D$w>oH~hH oV1) $)T$ HT$(dH+%(ugH8@HF`HH(HF@Ht HHtH9u:Hk QE LP1H5肌X1Z@HBݖff.fAWIAVAUATUHSHHxLfhdH%(HD$h1~ D$0oF oN0)D$)L$ ILl$LALJ LhHt~HPHtu@ Ao'1AAooIh LrHT$@D$ D$`)d$@)l$P贎DL$ MLI HAAHt$HHtHH5觎u3HD$hdH+%(HxD[]A\A]A^A_f. LLIgHtH@Ht H@H HI)A@IG@Ht_HHtWH9tRLJ 1E1LPH5wBfoo^)T$)\$ JL 貔fAWAVAUIH=ATUSHH;HHHHIHfH(H@@@(@8D3LhLhH@(@DpLhLhID$0ID$(fHH@ID$@AI<$H]IH1fH@@@@ @0H LsIGI$H$MIH5H4HHtHHDH9H<$HHLHH<$HPHHT$HHT$HH趖MFHEMLLD$蘍H<$HXHhHHlHt$HoHI^H}HHSH<$LpL#HLHH,HHMI|$IoAG ID$8ID$ M/IGID$ L8M|$ 3ftLkH[5ID$8HAHL[]A\A]A^A_@L5LR1VLiI<$E1L11 L@fDL$1H5j0HL1ɺ 1H5<E1=HH<$HpLg1ɺ7HHteHD$I1H -HӒH|$-fH<$bHHHEL1ɺ@L51L:H<$H1 L1LSG HLHHXHhH9u4f.HH9HChHs LHu1L>d H5腅L!11tH5dL1ɺ1H5.7&fL5p1ɺ^1LL HEL1ɺ2DL5MiLL訄:1fL,1ɺ/1H5oUf.HpM1SLH59XZfIL.11)H5SfHEL1ɺ<P5ATf1H]USHH@dH%(HD$8HH1)D$H)$)D$ HD$CH H@ Ht8tT61E1L ILH5NHD$8dH+%( H@D[]A\fDHxH5蘍fAuH11HH)D$)$HD$)D$ HH@ Ht"uHxuAlf.L L16H5?腂2L LE16H5T6L 6LSH5腌DAWfAVAUI1ATIUHSHhH$H<$1Ht$ LL$L$HT$L$dH%(HD$X1)D$0HT$8LLD$)D$ )D$@ELD$HtHx tD$AHD$XdH+%(HhD[]A\A]A^A_fHXHuDH[Htt$MLMSLHH|$HD$AXZEuL1ɺ1H5D $؀D $`M1LH5[血E1*@AVf1AUAH#ATUHSHH@dH%(HD$81HI)D$LH|$1)$)D$ HHH HDHѺfAt~11HGL)D$)$H\$)D$ Ht$HH HtDH肺AąAHD$8dH+%(H@D[]A\A]A^DL1H5df1E1LH59L1H5 VrfAWAVIAUATIUHSHH5}H(H;dH%(HD$1HT$D$ ftzLl$L赃LxLLHHtLLH萌HI $H;HT$ H5D$ HEHD$dH+%(u)H([]A\A]A^A_fDL-ALl$菈ff.@AW(HAVAUIATMUSHXdH%(HD$H1L$HrfLHH@ @HH;HxHHHǀH1H)HHkMvM|LHLL|$11fLL)D$ )D$Lt$()D$0LHLH5L,LH5LbLH5LpI|$hID$hHID$pHCID$pHI\$pHT$HdH+%(fHX[]A\A]A^A_fDHC1L1ɺ>H57|1Ly1ɺHH5|@HLLL_1ɺLH5{f.LD$LLD$辀LHPHH$HRH$Ht$H葉HEHLD$LLD$nLHPHH$;HH$Ht$HAHEPVL|$L#LLpLHtOLLHHEX01L|CH5vz1,DHEXLI1ZH5>zHEPLQ1UH5LzuHEHLQ1PH5z#zu+DAWHAVAUATIUSLHhdH%(HD$X1L$HfɾLHHHgHxHHHǀH1H)HHULHIH$fH@L}MEEIGpI_PLIGxIGpLD$!~LHPHH$HH$Ht$HIGHM}MsHELHx SAHEEHPPH5LooHT$X4tMLl$HELH${}LHPHHT$GHHT$LHNHH$HHHLl$ L11fLL)D$0)D$ L|$8)D$@Ht,LpHT$LLHEHT$HPXL0f11LL)D$0)D$ L|$8)D$@QHt,LHT$LLHEHT$HP`HInHIHAIFHL0L:HELY1H5wHLE1HD$XdH+%(tHhD[]A\A]A^A_ù1E1LH5cvHLHH1L H5#nvXZqL1H5LD$LLD$yLL`LHDHt$LHށHE@LH5Hht7L|$LxLL`LHLLH葁HEHHUPH5^HAąjI}L BLSL911UAj%H uML)1ɺ9H5s,@LM1LaH5rHD$HdH+%(MHXD[]A\A]A^A_f.L%aLd$f.HEL$1ɺH5#1E1drLM21LH5:rUD1E1LH5 r$@LM$1LH5qHE8Ld1ɺ ;HEHLI1ɺ/ HE@L.1ɺ+{f.AWIϾ/AVMAUMATUSHH$LD$HH@dH%(H$1HD$HHHHL$(HD$wMHhHHDM9u`M6M9LI^HHCHxH@{AąuLhHD$11Lt$PfLL)D$`)D$PHD$h)D$p1LhHtH|$HT$HL4HD$f11HeL)D$`)D$P)D$pHD$hHBfHHH|$HLIHfI^AHD$H8-HD$8Ht$8H|$ HL@MMMYAMAHCLHh|IxpI@pII@xIFI@xL0MpxHAH$dH+%(HĘD[]A\A]A^A_@HD$11L)D$`)D$PHD$h)D$pHHh HELt$HM,fHL!HmHJELMH|$LLL$^ LL$H@LhM3IHuL:HHfLhIgHt$(L0PXHD$ LH51mY^Ht$(LPHD$ LH5_1m_AXMLLLq<@HGt$(E1QPLH5HD$ L1ImXZLLD$ HTLD$fL@HSIHBhIIIIIIFIL0MpH/HHD$0rHPHHD$HDT$0HT$0HI9uf.HI9kLJHt$0HT$ MALL$IxHLD$vLD$LL$HT$ uA@Ht$0LWfHϟt$(LPqHD$ LHt$(L+P`HD$ LHHet$0LPHD$(LL$XH5,1pkH L1'H5pLnI}xHLHu,-MvM`LHUADžMLLD$mLLxLHwHt$LHvHLHCpAo[xAoADžHD$@L=11fLHHD$)T$P)T$@Lt$X)T$`HtLHLADžL|$8H5LLvLH5lL\DLH5_LBHH5LADžHH5LADžHT$(H5{LHD$0HD$(2HT$0H5TLHD$(HH|$0LHt$11HLfHLHH)D$P)D$@Lt$X)D$`MHt$HP Ht:tLLADžAHLǃHǃH$HC`ADžAHLAAo1DHEL1ɺH51E1eHD$xdH+%(WHĈD[]A\A]A^A_LL1ɺL1H56|ef.1E1LH5Ieh@L1H5e;HCpL1ɺDHT$0HHC@HHHH9LJ1E1L6H5OdL91H5&ldLD$8LLD$^iLHPHHT$*HHT$Ht$H/rHCPrfDLD$8LLD$iLHPHHT$HiHT$Ht$HqHCHfDLD$8LLD$hLLxLHHt$LHqHCXDLi1H5TcsL1H5$cCL1ɺ&1H5bL *HK@HH1HH9LNR H5cLP 1bHD$8HHD$@HY^HCHL1H5LbHCPL1H5bkHCXL 1H5aML HC@IHtAHHt9H9t4LJH1QLjH56aXZL 3 kff.AWAVAUIHATIUSLHdH%(HD$x1L$HD$(iL1ɺlHHHHMLL $eLLxLHMH4$HLnHHHD$8v/LMH u1L=7LLs`MvMHt$ LHD$ H5s H5HD$ HE`L11fHt$@L)D$P)D$@)D$`Lt$XH4$諻fHLcHT$(LLHT$0H5LkH$XLI@L1_D$0HD$8L 1ɺsH5 1N_E1HD$xdH+%(HĈD[]A\A]A^A_f$L11oH5^D$fDH4$11H)D$P)D$@Lt$X)D$`xHHD$8H5[LHHD$SHT$H5L7WEtHT$H5>WLHH L<PLL$HL1*^Y^Ht$8L%HEXHu=HHLPLL$H1L]XE1ZHUxH5:L-EExu ExfDH4$f11H)D$P)D$@Lt$X)D$`Ht%HP Ht:tHLHT$(HtHt$0HHk$EH}HH5 dH,HhHL`I8LD$8LLD$aLHPHHT$芿HIHT$Ht$HjH AxExHxLIL15\E1DH$L,It@L LI1[Hm`(HhHAjH}HH5CD$!fAHH;L LI1h[Hm`7D$HpfH$~LI@H|$8~EtHH1PLL$HLL1ZEt_AX]DHxL?IkEx$L51L1|ZD$(H$LIL1ɺ1HDž L ZE1dAWAVAUATUSHHH$H|$(LHt$HHL$@H+LD$8HdH%(H$81H<H@HD$H*HCHD$ HHD$Ht$ Hx Aą3Ht$H\$ HFPoo)$V$)HD$Hh`t <$H[HH{ uHCD$dHD$HOH|$HT$hH5YQH|$HT$lH5H3H|$HT$pH5_uD$pH|$HT$tH5uD$tH|$H.HT$xH5 HD$xmHD$x+HHD$P6aHHH\$0HD$XI@+L aIHHL)1EH VHH@LƄ$EHChHt HHtH9u.L S 1LLs>1LJHAWfIAVAUATUSH(HT$HT$pH|$(dH%(H$1HF)D$PfoaƄ$HD$ AD$`HHD$@)D$@Lo oSHD$8)L$p)$AQIPQA[]HIHC I|$ Ml$ ID$pHt&H/L9tfHGHEH(BHHmL9uMl$(LMl$ "I|$0ID$0HD$Ht)Hl$L7H9tHGIFL00BLM6H9uHD$Hk(L{(L5ID$8ID$0HtSf I_r@H I|$ HhHXb IT$(L(HPIT$(HID$(IoIHuIOIoH1Ll$8Mt$E1L<$ALLl$HD$%DAuHD$8HD$@<HMHtKID$`HLEE1LLAHHxpSHnAYAZAuHD$8HMH$@<HuDMDL<$EAELuAD$xEHmAD$|Ht^$Ll$f I^2?Hx I|$0HhHX" IT$8L(HPIT$8HID$8InIHu$MHt$HCHHt H9$L L-1 LH$LLt$4;1 HHH|$ LHH$LD$4H$H$DŽ$$E1$H|$Ht$HHDT$Ht H9>L  1 MLL?:1 HHHt$H|$ LHH$H$D$4DŽ$JDT$$$D!ЃH$dH+%(H([]A\A]A^A_H|$$E1L-H$H$Lt$4fHt$HJHH>H95H@H PL-L1L 9_AXH|$(HLHt$HHHH9H@Hh1LPD$1L8XZf.fDHt$HHHvH9mLH1 L˧ H558[LHLHH H|$(HL$IIGHt$HBH$H/HH#H9LH1L1ɺ*L7D$4D$4AG@AG<u AƄ$I|$@ID$@AIID$HAIGID$HL8M|$Hf1Lx1ɺH561(L @Ht$HHt H9L L1Lg1ɺA6Ht$HHt H9L I B1LK1Ll6IGIHBHD$4AG@AG<pI|$@ID$@*IID$HAH|$$IGID$HL8M|$HsHt$HHt H9L L1L_1ɺs5Ht$HHt H9L Y tL11LV|5Ht$HFHHBHD$4F@F<xu AƄ$I|$@ID$@2Ht$HID$HHFID$HH0$It$H>fDEO E{HD$E11LHFLHLHDLHHt$HfHHZH9QH@H1L6PD$1Ls4Y^E1$HD$Ht$HH@HBH$OHHHH9~LH1L1ɺ[L3D$4Ht$D$4F@F<AƄ$AƄ$AƄ$t1 MLL ^ DT$LB3HD$HH Ht$H$HH|$ LH$D$4DŽ$萛DT$FL 1ɺs1LL3jL ä L-w1 LL|H$2HD$H Lt$4H$HLHH|$ LH$H$D$4DŽ$њL 2 1ɺA1LLU2H H rHHHH9LH1LU1ɺ-L1D$4sHtlHHtdH9t_LH1L1ɺ^L1D$4AƄ$IL Y zL M rL A L 5 H $H5vH=v4LL61uLmH51u;pAUxATUHSH(dH%(HD$1;IHHhMl$8foHID$HID$(HAD$8fID$0AEAD$`ͩ3HwID$pH HH HH[;HHHI\$ HLc3HH=!HX@lvm2@VH!HH=ԟHH!HPHLH!ID$XHmHLLl$$HD$MHHiI|$X7 ML$(11LlS H5Q/HD$dH+%(KH(L[]A\A]ù=H-LjH /Lp11_H.1LoC H5.I|$ HP(I|$XHtdI|$p3LE13D1LH5q.L1ID$ > H5D.fLo1ɺI H5m!.^@Lo1ɺO 1H5H-4]8L4 H5-LE12l% 1LH5-EAWIAVIAUIATMUHSHHt H:!u#HH!H!!H$LοHH$HHTHH,E1HtHET$x9dM{I$HL9LHH D$pLLTLPD$hP1t$h,HL$`LjHjAW$P$D$L$H$VH0LYEH!L%!HoHPIvI$HLH~PIHHxI$HH$H$PD$XD$hI_8AG4HtHUHt HBD$xMtAEHL[]A\A]A^A_fL$XT$hE1ʉH9PAMHLi1ɺH5R1+_L [@MtAEMtvI$HtmL9thLHLE 1H5*H{E1D+ID$IHMtAEL I H?Ht$^IHfLL$HEDI$HtL9u*L L1ɺ1Lֿ*ALHf.Lk1ɺ1H5) f.Llk1ɺ1H5ՙE1)HEL 1H5t)ff.@AVE1E11AUIIATUH1SHH dH%(HD$1HD$PHD$PjjjjjjH@IHHMtHLj3uVH1IUL H5 (XZHD$dH+%(H L[]A\A]A^@AFLE1 _H1AUIH5LS(Y^HLnM1UH5h(_AX\2ff.@HAHHHf.ATIUHLSHYHHS_HtHH` []A\DHL[H]A\6fDAUIATIUHSH3!H!H,H!LHLIuLHPIHHHH9t[DHSLLQHH9uI$H9t2E1fHPHHHAH9uEu"LHL[]A\A]Li1ɺ1H5w&DHٛH!H! !HCHHE1z1Lg1ɺH5%%HL[]A\A]ÐAWIAVAUATUSHHHjL@dH%(H$1D$|HEHuHD$HtHHt H9HH HD$HHH9u[HH9LHHH;q@uRDIxHL$|H.9IH IHD$ H!AGEo D$@AGD$THID$ L5DLFH|$ LHT8RPC(Wt$(LP1$M|$ H0IHH-I9/AD$<ID$(It$0HHD$0H Ht$8HT$9HD$(AHD$8HD$0DO\C(LM9LT$HHLM{LU LӸLm(t$0t$Ht$0t$PP1#H(C(Lj LAULܸAWLT$hARLT$pP1#H0LT$HH|$(L;T$M9LT$L L0KDLT$G|LPC(gAUAARP15#D\$`H ESAL\$0HD$LE) LARDLN<*JD8DT$0PH)кPC(P1"L\$PH DT$(M9H}Ht$It$ c7jC( AWLl$(LLLWAUP1m"H}H LHL$ L3 HE/ 9XXu H  D$TE0AH$dH+%( HD[]A\A]A^A_fDH@HD$Gf.HD$(AHD$8HD$HD$0IM9MBL9|$0LS(HLҶt$@ID$ H-PAUt$(RJL1:!H0HCE1HX@HcH;&HHCfC0HL$HLBK0,LHALIzfC4HHDŽ$)$H$HX@)$H$m!$)$u %H$ƿr+H$HH$LH.<$$DhH$T$@HD$ HMH|$ D$@Eo I?AG HH{HHD$aVHsHT$H; HT$HCHHzH{HHt$ DϦD$TAGg@PC(LAULt$LP1>H HI9HD$(HPHT$L+|$K(LIHItH)HLRLtLARLT$XP1Q M|$ LT$hH II9NH LhC(LbARPL1`M|$ H ALL\$hHLL)LHHL$` HT$PRLL)RAUARL$P1C(Lm(L L$H(LLLU t$0t$Ht$0t$PP1H(C(Lt$P LAULt$pL$ARL$P1]H0LT$`L\$hH|$(HD$0Ht$XS(LH9Ht$H9I9HD$Ht$HLM)HO/LHLHHD$@HHHH|$ L\$8HPJDVAL ASP1ARLT$XWRmD$H@ELT$(<LT$XLL\D)L|$HL\$@LHD$8IωL$`LQPH)HL$8 PC(P1HL$HL\$`H LT$XJ)L9M9LICL9C(HLhASAWARt$(LPkH'L1uM9L9|$0L;T$H$f LL1}H5};L)HHD$(HHT$HLLASL\$8ARC(AWt$(LP1L\$XH0HD$HLME1HD$0LL\1ɺ1H5|TL&\1ɺa1H5|i.HLIchPQ H}Ht$LT$(It$ .AWLT$0LC( LARLd$(LڱLT$ ATP1H}H LHL$ HT$A+;MsHC( LAWLd$@LLATP1HL$@LLL+l$hH}H L*LL$LL=L|$HM9LIB8ASD$hLWLL\$@PC(AWARLT$Ht$(LP1L|$xLT$XLM9IBH0L\$8LLث1H5zXLL$L1Li.L]H5yD"f.ATL%!UH-!SH]L9t)HEH}HCHHP(HHHL9uH![]H!A\H!ff.AWAVAUATUSHH(dH%(H$1H\HHt H9L 4 L5X11ɺ{LկLPC`̐C`HD$E1Hl$HD$1@HMHI HLHR# HLABELONEH9D$uAL9|$tvIIuH$dH+%(D$H([]A\A]A^A_Ha!L I9uM$$HE!I9tI|$LHHtHHt H9L  H11AWLL&!X1ZLH4]H|$H8HHwfHHt H9wL HL]L1AW_AXf.CHHt H9}L / 1L1ɺLRsXH= HKC`̐C`fH8D$HHH9LH~L1LfDLHKLHkHHtH9uSL T HL1AWLCnY^D$LHLHfL A@L 11ɺ{L5LL%`LH[f.11`1`AWAVAUATUSHH $HHt$AAT$AMLˉL$AAdH%(H$= %D$ u(5b u(A Dl$ tKD$ K!tغH5Lru!D$  t$tt V u5L H=T!oHCLL$@ML$HD$PLD$@- EAƅH HHL$(L>HL$(H= HLIpH;5 JHteIL;r sXHtHAHh  L] HJJ t$@0 IL! EL= M_LLP։T$(T$(LLHH1Hx&L!ME1D!6Dt$ Eu E1ۃ !HHh!D H=!H ЋX!H)L5b!L S!LD!HHƒDl$ H5EHjASH$PWLAVLT$XH0LT$(A2H c!HD\$0H=שLT$(:LT$(D\$0u.H IHLt!MD!E1ۄH!HHt$T$1ɉL$Ћt$ H$dH+%('HĘ[]A\A]A^A_@D  EL!ME EES  /D$`= 9i ![\ Lt$`+#ƒLs$L$L1HhL.hfD o;HCL CsHD$P|$@1 L$t # @L5A!H=*!MiHoLL$ LL$ L2 LL1H0)LHL$@LtL !D* D$`E9-ư R~ D$/D5 ED- E A|$`6Lt$`L=  La!HJ LH=H HPD$$PLL$ 12AYAZoHCHL$@LH= HD$PT$@cH HtH HQH H9H5ͯ H= o5 t4 Ͽ oHCHL$@LHD$P\$@qD$ H 9!H4H=Gt E1ۅu;2Eo MHCLL$@H RFHvD\$(H5xHD$PL$@-D\$(H=HtO% 0uPO!TfDDl$D#- D|$ E֎ Hl HLt$`ƒLoH= L } L1Hͤ fDHcH5VH4DT$ CfD 4D|$`Lt$`8Dq ELy!B@AL!6fDL(LLPչHH= L | HGPDD$,1HL$ _AXD$ HLD$0HD$8H5$ HL$(LD$0HHT$8H8H {sLHnL >ao#LEHCd$@HD$PD$ H=!IHHH!H)I9H$H0I|5H|0HxLHH)H)H L9 L۱!L$HLD$$H\LPLL$ 1aXZDHi HL$H A!1H4lLaL_!Xpo3HCL _HD$Pt$@o+HCL _HD$Pl$@H?i HH@i L0H!i L0H"i H8$ɉ0At tAt ftLH=ILL$ LL$ H ź H=κ 7SHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H!HtxAAADH!HtfH!H$IHD$HD$ $(D$0HD$Hj!HD$dH+%(u&H[ÐHg HyHg Hff.@ATUSHH0dH%(HD$(1tHD$(dH+%(upH0[]A\DHLd$HL$HLl$HD$HHL$ LLD$ D$ HsHmtD$ )AWAVAUATUSHL&L9IIHDI\$I1LHHPIc`HC0H9ufHH9tH;XuH@LHL(HHtkfAGM$$M9nH[]A\A]A^A_ff.@HHBv dH%(HD$81uHD$8dH+%(HHDHL$HE1E1j1jj46H tD$tD$ Hc|$HHH H H%H MHt@atpXH=Ȧ HD$H|$aJf.USHdH%(H$1HD$H;6~HHHHH OaHt^HH HHHtAu}87 uCHt$HtH|$uD1H$dH+%(uTHĨ[]ÐHu8HHL$A@  苮t|$LVM-v" fAWAVAUATUSHHHT$-|HHX IH1f;u H{rlH[HuDmtqIc` HHt\I^ HtKE1L5f H[Ht3;uEIcHK1E)HLIceA9~ H[AHuHD$H(H[]A\A]A^A_ff.fAVIAUATUSHdH%(H$1IAx\LHI@`L0MA/@HL/IE HI9sL)1AAHH9uL IHt^HtTH]H9u8H$dH+%(u{HĐL[]A\A]A^fDHH9tHL9 uMeH$dH+%(u+HĐ[]A\A]A^DLP IHf ff.fSH5B t&8!t*!u_ [Ð!uE [HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uH f.AT(UHHS IHtHhHELHPHL]A\Ã1LH5nff.AWAVAUATUSHdH%(H$1HHL-nGa[SXHHE1L|$H9L<$fDHhC`0ĀA@L5d[DH1?ADžu AĀ~HS8H1LPLqAU A%A кP1H HHHBBHH9t H9HS8HLLzA A%A кP1[AY1AZH$dH+%(mHĸ[]A\A]A^A_@A@L5.fDH4$DHC8x H9D$8!L %I鿄Lq 1R$P1YD^]A@L5LDKTHH9tLHQL1RLQ_1AXHHtPH9tKLHL-lL1Lc`a@L m y@L m 1|Hc E1K`L4$EH D{THHl$LIDI̅Hi E1@AHA9tc8uLD0IHH9t HtLHL m H1L1AV9LAWt$"D{XH H= M$L;HHJ MHxHHǀHH)HHH ډq @HH9t HtLHL 6l 1LLV1LIHl$1LLd2$DuCT184I1PHɔLPL9<1XZ<Lݓ1LH5 IHl$Vf.AWAVAUATUSHl dH%(HD$1H=0 t)HT$dH+%(H[]A\A]A^A_fD9O؉HB!H3!;!8cIHH`Iu IE IEHIEHIEHNtIExz XHnHPHHWHHPHPHP HXH8HHHHJHH9uHPIE(G!AE0IEA1ɺ}LgH5U1LL1ɺ1H5g!06HrH={HH IH8H=HNsHxH={HxHPHH(HH HLH=!AL%{!LH HHHD9LcLh (DFHLxDpLpHH@XH@@LpLpHE`HEXHEhHEpHEhHExHHExHHH+HHLDH@HH@H@ HHDžHDžHDžL$$MLHHE0HsHP Le(LHHt0`LHEHHjHJHHEPL2HHBHHUPH@H9u 5H HHt=HHH-` H*@ aLiLAULIT$At$L[LAH91Aٹ'LH5eHܗ 1V!Lɗ1ɺn1H5,fHװ!HLL1ɺP1H5GL1ɺ_1H5_!HDžLAUH@1L!H5 d1IE(L1ɺH5NLH E$H59H=-9m(Hpff.@AWAVAUATUSHXL-W H|$8Ht$(HT$0dH%(HD$H1M/HD$8IDpXEIMHD$(1H|$0H HHL$ IHD$(H1H|8HHH|$HH$HI9s?fLDLII9uIMHD$(1H H1IHD$HHH$L9<$HD$@Ll$Hl$0HD$Dt$JfDHT$ Lt$@LH)H9HGI^IH1I|LL)M>L9<$LD$t$1LH|$KLCL~15H5HAL$M>I9@Hl$HLMLd$fDHIIH9HMgI1LLHuIIGHBHH$HD$IH$IGH$L0A$L$tI$HkL9bLH=h L;~?11H5GM$LLPHHtnfIA$AF AFIHH9f.HLd$Hl$L}1GH5FAL$I9t(f.IIV1LHPM6I9uL$I9t#DIIV1LHPM6I9uH$D$THD$(H$H$AHD$XN H$L=śHLHD$0D$D# dDIA L=Ht$0L(EAt*H1L}r1AWH5dpXA_Xp AuD$DHt$(HT$TLQD$DAuD$TD$D LVr11H5oH$L|$(L7H;|$(tHGIFL0LM6L9uI7AutbD$D`11L{qwH5Po?Z D$DAu u DD$DHLՄHD$D$HD$hHD$`HD$p1L9t fHL9u@E11LILyHҍ!HH;ď!DT$EH|$`L|$L7H;|$t@HGIFL0XLM6L9uT$LE11LImH$L7H9t$fHGIFL0LM6H9uH|$pHL9t#HGHCHHHL9uH$HH9t DHGHCHHHH9uA`< SIH5=H5H5>HHND D$ HHD$8H;D H9H$Ll$HD$0fƄ$HD$0)$)$oJT)oRd)PHjHBHD$LuH9H$I9H!MH5oLL$L$HEhHT$H@8H%;I$HL9 H@MMH <H5qLDHLz1P1AW$H|$(H 1ҹLILL9t$ILehI$HcHIcIID$pH$HzMMtH5vnLuHEhHL$H@8H%;jI$HH B Ll$T$DAnA@`t$DLOfDH D =C LVwH5?HLHH)HҺLE11L]w11MH5?DT$E AtH$E1H9tfDHAH9u1L+x1ɺH5(?3E11HILHLID$DD$pL @ @D$ \I$HL9H@MH59MLLDH1ɺPLw1AWH5$oH IL9t$xDHT$8H <@ HH9HD$8fDHt$(LqI$HL9LHLk1ɺ1H5#1I$HtL9tzLHH11AULvH5AWSH HAd$`eH|$1LHHPHt$01tZHefDL ? L > 3@H> rIH5+IxL~s1ɺ 1H5<A@JLIi1H5<LUi1ɺ_1H5g}D$Dp1Lj1ɺH5`gOH> H9L t1ɺ1H5/gL 1ɺYH5fwH11AWLhH5fXZL[h1H5;Lhh1ɺmH5fwrHK= H9#D {\ E1k~HD$HD$ Hl$0H\$8Ht$LIHII9tL=< HtLxHl$`H\$H9ufHmH9tH}LKuHttAFb cHIƨHLHL$HHL$HD$ NHD$Hl$0H\$8H@Hth L|$I?PLHL|$`HD$I9tL$Hl$0LLd$MIH+DHNHFI3OI3GH HmH9tt<-tL1LWLIHfƄ$I)$)$oA)AocA)gHPI9t7fDHBhHHI3HI3GH /HI9uHEHuATLrASHIH VH0I ȁA1PA Ѻ@H5c1H D$Ld$Hl$0Lt$ L$)1LeH5cppAuOD$DJ5 0LAp1ɺ1H5(cHD$(H9$11LeH5bAueD$DHEQ1AVLpHIH AWH0I APA H5ob1\H D$HEAWLvoH59bHIH H0I ȁA1PA 1 _AXD$HEHuATLyoASHIH HI 0V A1A P8LUd1ɺL1H5a\Lc1ɺH5ga[VLc1ɺH5Ca7H$L7H;|$(tHGIFL0LM6H;|$(uAHt$(HT$XLHD$XHD$H$H0HD$ Ht$H9Ll$0Lt$(Hl$8HHUHHH9L$LxM9uDMmM9I}LuMtlH|$Ht A<-ttIuBHMHEHAHH|$pHD$xHt$ LeHEHD$xH0AHt$xHt$Ht$ HHH9t HD$Ll$0Hl$8H$Ht$H ])HHE1H9HH9uHD$pE1L9t HAL9uQLk11RH5b_LHt$8H|$uH|$ 3A[A^D$DH h$H5b H=s nu1obfATL%^11ULaHLHteu1@t,GHBtNH]A\fD1ɺLLU1ɺLL5{HLL1]A\fD1ɺLLaAWAVAUATUSHH $HH $H8dH%(H$( 1HH5\AHHHl$ AľL5l!1IHLHZ`oEAAAALH`1H5P`L1ɺ<1H5_E1H$( dH+%(H8 D[]A\A]A^A_fDHl$ 1IؾL%k!H_HL1HMLk1S7H5__T]A\E1gfDARAA L$ DHk!L-k!DEL9u@HL9L{HL]u|$ ML-^L_1Ƀ"L P1AV{DwZYmAfHc eA~DAWAA L$  IHuHIEIH/|$ Lo^AEM}1Ƀ" P1AVL5^LҿAXAYHq@Di!E 1ID$H$ H^HRHߺLi^_L$ Ht$HjA4t$H L$ HL8HILLViP1A[[fHMLh1S2H5\贾A]A^L$ HDL11;?t@H=h!Hrh!IEHoh!IEL(L-ah!@11>I}>L6L11LL$ LHt$H߉b YXSoLLw11H5\躽LQ1ɺ1H5[蔽ff.@Fg!HOg!SN Ng!Dg!HtwЅt 3g!tkL[1H5[[f!S!N f!(N tw DUHЃEeu;~xu5~u/H5pVt]fDst3uu^~nuX~uRHH53V]D~huǀ~uuHH5U]cI1zLjfH5Zٻ1]D1LaZ1ɺfH5pZ读]AU11IATUHAąuD]A\A]e!tLHAątA]DA\A]D11H5Hmff.AWAVIAUATUSHHHQ L'L9 H^ L9 %H> L=YAL9 DpŅLfD|D9t,PH5HTAAULXY1eY^ LDIHHH;&v!pH;)v!SH;,v!6HH[]A\A]A^A_1LdH5SԹH1[]A\A]A^A_AL=XD[ŅL8HMLePHPHRP1H5)SYH 1H[]A\A]A^A_@84A?MHIHRHDHH APH5RL^eQP1H D跹;z8ÿA?MIHeH6RHDHH tWAPH5ORLdQP1tH  8UA?MIHHQHDHH SAPH5QLdQP1H DL=VE1!fHs!@Hs!@Hs!_8訾A?HUMIH QH "HDRAPLcQPff.AWAVI1AUIATL%}ULSHdH%(H$11IljLTHÅ袸jHc1LLH5U?u,)LͼHtHxLH5a1t*1L e|1ɺLUH5FPv1H$dH+%(H[]A\A]A^A_8M1IHChHHIHIDL<@HI H9HHphL9sIHDL$HxjfHHD$A[X&1HHHD$IDL$HxjLy_IXZ1L\$"ASLT$ARL(SLILDL$Hx$HIIDL$Hx$mHHD$Y^.0AWHT$LRIL^1LR&L_1AXM9rH[]A\A]A^A_HCPHHshHDL$HxjHIXZ/HHIIDL$HxjY^AWATIL%Q1L.LZ^}_MAXL21L^WHCh1I>HID$DLHjD҃HLHIHDL$Hx$LL%^I41H$譱AYAZ1H[]A\A]A^A_L^LHLLM9MAARLIHRH| HH9to8uHPI0HJIPH31H3QH u'IpIPH3qH3QH uADIP@HtHI@HtHI8H9J8tHH9uMM9XfDH1L&1ɺH5Ok1H@UH5fHAEt[H5THAEt?H5fHAEt#1L\1ɺH5I1]fATUH-R SHHtKuGbL%k!MtHLH=N臼[]R A\ u R []A\DH L L%@k!8t5HMt-LHhN1G[]/R A\HY L @ATLL% tHL% tLE1ş'L\1ɺ71H5>E1蜟L31ɺ+1H5>E1sHPI}ީADžHE1LH@PHx HXIHHE1E1I$@1E1HDžPLNH5>ޞIHD$H@ID$Lb1ɺ21H5=LE1蟞L61ɺF1H5=yLX18ѨAWMAVMAUAATUSHH(dH%(HD$HGH@PHHD$kLLH%Aą"HKH{HQLGXHH @iHPIHGPH5,L8LD$HH@ H@XHt1HT$LЅL=<11ALbML=CHCI|$HPHH Hw`;A$HcEHHKDmTA A&DLt1ɺ1H5;跜HD$dH+%(H(D[]A\A]A^A_ÐAL)11H5;lf.HEaCTdHH{HpP4AąL1ɺ1H5.;HHLHI9I$P A$HID$L¾CH@PH8z\ID$H5H@PH(HmD$HH@ H@XH1HT$HЅD$L=@:1A LTLL9HKI|$HQID$HQHh`;HH DHHHH9EHCH|$HHPXyAHK_fDHH@@dNHHHH9L$LJ1ɺ1H59@~f{L=8IL1LFI衙L=1ɺ1LE1聙@ID$H5H@PL8L] D$H<H@ H@XH+1HT$LЅD$L=581A LIJLHKfDD$H}AąD9mTLt$HDAEMA$D$I~jGH{ZYI HuTI~IAEMA$D$j^_AWATILH1ɺH571AXAYDmTH7I$PI|$H}DtAąL51ɺ1H56xL=61ɺ1ALkGLFALGL1xfA1ɺ1LGH56@Eަ1WL=51ɺ1ALFL視`L=1ɺ1H55耖ALG1 H5{5QL=e5A 1LyGL#{I|$I ff.AUATUHG`HH-H4HHH9إHRB@H,HHE`HEPH8AąHu`,1E1E1j1HjяAXZE+HEPHL(tHLkD]A\A]HH9uH4sIfHL_FI1E1H53ΔD]A\A]DHHH9ĤHHzHH8LdFIH531aD]A\A]HLwFIKHL,FIH5%31@Hj(AH1ɺUIH52LwE1踓Y^GctHHH9t1HH9ut1DHH|$RHt=HPHR`t-H2r&HH|$H;xuHf.1HfHHH9t:fHPHt HJHtHhHt ActH9tHH9u1@fAWLAVE1AUATIUHSHHdH%(H$1ILHHH=2L9IDHD$@CHD$8HHLLI9IDE11L$|$Hu\HD$PH|$8HHHPHSHPH@HSHCOH$dH+%(HĘ[]A\A]A^A_ÐHHHVLxDPDL$X1H5M1jXZH|$81f.LCGH5 1.1]H LCLIH501H LCQIH501蹐Lff.@AWAVAUATUSHHLwPHdH%(HD$81HM>H9HCH@LhMHH@HD$HHL~AąHu`Ht$HHǃhhAąH|$UAąjLBHIu`4L蔝L1H5\ E1LMHLm9L7LMHL8L-H|$(1-UALv81"H5E1]D$H|$(1T‰fATUHSH|H5H證uEB[]A\D#ABt^H5 Ht;AJu {t/1L8LH5 ~1[EJ]A\f{}@1GduHHH9ЎJLtHH IHPHt HHHH9HA@ uHH9u1ff.GdtfHHH9YHLtDHH IHPH| HHHH9*HA@ u=HH9u1ÐH1L61ɺ{H5{}1H@HHAWHAVAUATUSHL.dH%(HD$1I9AMLIԅHE1E11ېIH@HHpHHH9jH@@ tHHH$aAL4$A;]Lr1EM4$HT$dH+%(u!H[]A\A]A^A_E1AWAVAUATIUSHHhT$ L$ DD$$dH%(HD$X1!IHDT$ IGIEDKLED$(E1L|$H$DDD$ H@HEH4$HDED1DHe HpFHLM|LIH1LH|LHcL H LHDLDH1ULD$ HZYHt$LL _(H$AD9hLWL|$@H$HHD8AAcH\E1SpH߉T$,KD$(HCHHHD$~T$,If.1DH3H 7L(41fH5L|$yHCH@HHCH@`H!H"(HPHBH@@HHHt{H9tvHAHD$H$DzH|$PPT$,}T$,IHlUpHT$,H}HD$(H$H|$HD|}T$,IjfDHQHD$f.1 LqH5wq\xLM215H5y8xL 3~H5JL|$ x@L31oH5L|$wQfL21yH5L|$w!L11`H5L|$yw߁ff.@AVAUIATIUSH@HndH%(HD$81D$ HD$Ht EdMIFH@ Ht0Hxpt)= H-Zu I|$2fH-|HLHtTڃruHUL@HIHHTHTHL)H)ڃr1L 9M 89rHT$8dH+%(zH@[]A\A]A^tMtLfL@Ht.HEPHظHHHxjID$HHCLHI99fIF@tAF1 t)H-fDMLLIt$ HFPH8|HL$HE1E1jjjH QD$EIFHT$Ht$ LH@ Ppf|$ u!|$T H-[=H-Lff.HATHI4USGHHHcH>HWPHBHHRH9HHfH*fHWP-HJ 1HHR(HH9gHNfH*HfH*IfDHP<G2Hk@HHHH9LEJT1I@hHDHHHHH9H1HH9HfH*HfH*fDHWPB8HJ HHR1H~fDOHOPHQHt]HI1HtRH9HpfH*HfH*^Y,=D[]A\HG@H@@GpᐅHGPHPHH+HHbfHOPQuH1t 1H9qHQHo1HdH9t/HfH*6fD&fDHЃfHH H*XfGxHfHH H*XfHȃfHH H*X{fHJHHR1Hf.I@PHHDL$HxjxHsPIHEH6H@PHDL$Hx$1H}HXZAT1H5oSILu+1pY^HJHHR1Hf.HJ0H~HR 1Hjf.HȃfHH H*XfHЃfHH H*XffDHfHH H*XfHЃfHH H*XfHfHH H*X{ff.ATUHSHH0dH%(HD$(1Ld$Ht$HD$ LD$ HD$t1LH HL% L*18LcnHE@Ht HHtH9umH D$ HMQLLKH LHHDº:P1nD$ZYHT$(dH+%(u.H0[]A\fHJf.L% a/xff.@ATE1UHHu2HE`uu H"s-DH`\IHt@L`HL]A\fH!rH.rH/rH&rH'rLĮ1ɺ1H5H mDHW`H H%rH @t f.u t H?@HA1EtH HÐHHH9AUATUH HH9t8@1 tH9HAHpt&Ht}H]A\A]<@E1]LA\A]@HF@HtgHHt_H9tZLjHLpHL`LIHtLLHy]A\IA]LHHhs@L-a@bt9HHH9|HH@&HHhg1L '1H5v 5kE1ff.fHHH9tYHtTHPB t HBfu-HW`H%rE1H-rL@HL@hLÐL LDE1LfAUATIUSHHFPH8HHCd HkPHEHhZoHIKoH{HH?oIl-LHH IH1HHSkHCPLKHHH6LHL1HhVxrHL[]A\A]@LIHtHL[]A\A]f.LH 1H5lif.1E1L H5z9ib@ATSHHHdH%(HD$1HH9tOCbtIHtDHt:HpHCPHL$E11H8萩AątaE1|$A/E1E1Lz$H5hHD$dH+%(u4HD[A\fDL1ɺK1H5GhrATUSHHdH%(HD$1AąCdHHHH9HxVHHPBHL H1HVDH9H;uHxHȯAąH$E1<(AAfDHD$dH+%(HD[]A\LKH^L;#H5[1E1gLKHfL3#fH@HkE1L9#LHHsH1H5fXZKLKHuL#kfDL,1ɺ|1H5ofpDAUIATUHSHHHt\HLkL`HEPLHxHHtLLH"tHHHt8HH[]A\A]@!!t&H h !HHu1tHL% !Lgus!!f;o8lL IH51]eL0LH1f!!ff.AUATUHSHHHGPLhhMLgHMt_L jIuLLI W"u3LKHL!7H5dH1[]A\A]HCPAmLhhHkHMtNHtIHiHHLHEe(t<E;eu"LKHCL4!/fHsHH[]A\A]@LKHAL#!1H5QdH1[]A\A]AUATUSHH $H(L-HT$HdH%(H$1uLGH|$Ld$D$LhHHXH|Hts:H$dH+%(H([]A\A]HT$HxLHHILHLHH) H)։H롐H|$vpHHMLd$LLpH44T$PATfT>fDT$ۉATT"lff.fAWAVAUIATUHSHmuxHFPL%HHXC`LHL- AąBHLIH5&1arAƃA HtjtehL=1ɿIL1LjaHLpEAHD[]A\A]A^A_DL=1LIL1,aH@LH7AąuL1ɺ1L`L%HEPHHDADHEPHH7A*Hs'HL  H(LLI1U`HL=}1LIL1!`HL6L1ɺ1LE1_zE1ATIUH SHG`H*H-sHHH9II$Ht HH%A$H"rH!sLu]ID$` uSI$I$H9t>H$M$AAHrHNHA`EtH$rH29HH9uL[]A\ÐM$M9|oHI9uHH9uDA$%HJXHA`LuI$I$H9uDHH9sHCHxtLL)IH5_1^HCL`&ff.@AWAVAUL-ATUHSHH8Ht$dH%(HD$(1HHD$HH9¸HEHD$HD$ H$@H4$HdLd$ Mt$AIH5*gM~(I<$Mvh辿M]lAH }}HE11PL1L\XZEa}HD$Hǀ`@2XHEPH8 D Et uMDEMu貭 8cq HL"LI1[HD$D`EE1DHML=&LwH1P1[A\A^ HLE1PL91ɺ1k[^_EaH1ɺLIL+17[VfafDL12H5Z1ɺAL}H5ZHD$(dH+%(uH8D[]A\A]A^A_I<$AH9L1ɺIH51eZL1LAĺBZotxHD$Aǀ`HD$FHD$HAǀ`n/AąL1ɺ1LYH|$QAątEHEPH8D Et uEDE<0`2L1ɺ1H5tJYwcAWAVAUATUHSHhLdH%(HD$X1HI9ƸLDHG`H0H2HGPL("HAŅOI@e NALHEPHm`,HH8FH6Hu`,Ld$ LHUAŅLMAŅILxLLH0AŅGI@I0H5zHD$I8HD$I MHD$IGPH8II9nhIFHuL(NAŅuE11H1LLAŅEpAGpHEhIo`2IGhI0HtDHD$I HD$I@HD$I8HIl$`4AFT IH11LLlAŅH1Ld,AŅLu1ɺ1H5VHE1E1jH1HjLLd$8ATH :D$ f L1ɺ;IH5c17VLAŅtxHOAŅA4D5LIH51E1UHD$XdH+%(HhD[]A\A]A^A_LL1ɺ1H5UDL$1ɺt1H5gUDHHH9fLHYLI(ILL`mAŅLH-AŅLTNAŅLe1ɺR1H5TL<1ɺp1H5Tf.L 1ɺD1H5yOTqf.Lܕ1ɺH5Օ!TJ@L1ɺ1H5!SfL1ɺP1H5Sf.L\1ɺ1H5Sf.L,1ɺ1H5oSf.L1ɺN1H5i?Saf.1ɺE1LH53S0fL1ɺ1H5 RLv1ɺ1H5R]ff.@HG`H0sH2szH$r;HHH9/cLBXLfDHHH9LBXMuLMuʩtJHHH9bHL@Lf.HHH9bLBXMj[Z@E1LÐH%X fDHATUSHHdH%(HD$HG`HDH HHH9HH}@HHHEH}@*HBAąWHK`H DMLEaHH!D1H"1@tLI;\t,tLI;\tD@HHH9uE9H$E1<DA4H9BLKHL H51E1LKHL Yff.AUATUHSH1HLoHt-H]PLHAątOHA[D]A\A]AL11ɺQH5NHD[]A\A]fD1Lb1ɺTH5NHD[]A\A]fAWAVAUIATIUHSHH(HHJHH@HHH*HH@HIEI$HtADEt9H3HH2IuH<H2|@HID$`HX O$HH5HHu E$EtHH'MuL;H&$H$H%FA$ID$`HHu"L肧ID$`ufDH H/MuHL$H.L= LHL1tH>LH{1LO1ɺL%Ⱥ1LLL+1ɺr1LrL5DM}L3Fu HWLH0tH LH0:L1ɺL%+1LKL11cLKHa LH~0 H LHd0 ID$`$ĀH LH50)ID$`L1ɺ]1H5s?KH3H $$H([]A\A]A^A_@H LH/H LH/$ID$` LCH5CJH1L QH5{J$IH"MuL;H! H LH.I$I$H9ZLpIF @QHHDID$`fD LBH5BIIE1LVH5ZIDL訣pII9H H$HHD$IHL$HI9T HsLxSuHL$H$H$L= HHI9\HsL@SuH$H9 LHf-4 MD$`$I0'HT$Ht$H5-L 1ɺf.H) LH,tH LH,pL1ɺhDL1ɺDHLH,tHK LH,L\1ɺ\L%յ1LGL811mLGBf.HLH, $ID$`DHLH+tBH LH+t,H LH+t$ID$`DL1ɺa#DLID$`H00tHt$H= HU+Lu]MD$`I4I-^fLLMuHHAAAAbLREtDH LH*HdLH*iMD$`Mu$H`IVI(s@H8LHu*IuHJHZ*$MuHA$HD$/IL=uI9H\$HfHL9HsLOuH\$HLH)ID$`t H$TA$ ID$`H7IuH, H)IuH) Hq)HH; MeH|H I$H HHHDHL`$HBI$*HLH(tHcLH(XL1ɺDHLH(;MD$`$I0wHt$LH(MD$`UDH LH^(v$MD$`%DHLH.(tHLH(L1ɺ L%e1L,CLȄ1ɺh1LCf.HYLH'&II9HmH$HHD$IHL$HI9? HsLMuHL$H$H$L=HHI9 HsLLuH$H LH' MD$`$AHT$Ht$H&LL1ɺSL1ɺDELL 褼EH|LHa&B MD$`MuL$1ɺL%1LdAL11wLGA fI$ID$`BH$7M>HM9vH\$LI HL9THsLhKuH\$HLH%La1ɺL%ڮ1L@L=1ɺ1L@GL;A@MA H LH%_ H)LH$E MD$`MuBHH;M$M$M9;E1Hl$E1LH\$H5ELJfHEPH1ɺLLuH1?ZH5YM6I9WIF@tA~LDEDD֐HHDd$ $DT$) E-fD$MeHHxI$H HHH HL`HBI$Lt1ɺ1H5>zfH$HT$LH\#t.IL=I9DLLH2#L1ɺH\$LLH"L1ɺ kfHLH"t:L=LHL"t!ILH"Ll1ɺCDHyLHf"~HLHL"dI|$`H$&I$I$H9E11@HH9~HPL;bXuAH\$Hl$H3EEYH3HH!L~1ɺH5<$ID$`LL~1ɺ1H5êHM9`H\$LIDHI9:HsL`@uH\$HLHoLYw1ɺzHt$HvHV$L%Lw1ɺLe5H$Lv1ɺLv1ɺ)HJLH_Lv1ɺ!L|$HHLtHZLH9Lkv1ɺLXv1ɺH\$LLHVL*v1ɺrL%Lv1ɺLY4H-HD$HtLHqLu1ɺ$Lu1ɺH5&3Lu1ɺ:H(LH Lau1ɺ'pH\$LLH_Hg1HLH-iIF"}HLHcLt1ɺ7H9LHLt1ɺu!HlHD$aHLHp-IF@ HLH1Lt1ɺEHLHLs1ɺ.HLHWLs1ɺ1L%Ls1ɺ*L1HLHLWs1ɺ?fHLHVL*s1ɺB9L%Ls1ɺ;LY1(HLHLr1ɺ4f.H$HHH9AHH@HP`H0ruH%r@uuff.V9WrfDHHNH9ff.H 1H9H9~tDFF;BHLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfAWHAVAUATUHSHLL>HD$LfI9NAFL1ۅu)A9^LIH @HHʃ:uII9t%HRHz1H9xHDL9uu(LH $IHfH@ H $@IHDH@IEH@@HHHH9HRHEP LH5LR1uH.I?ZYIGM}IEIGL(MoA9^L@M6L;t$H[]A\A]A^A_fDHe@1LTH5@ .H1[]A\A]A^A_H d$H5;sH=Ls0ff.ATAUHHtHD]A\@H耨uHE`H&rHxHE1љAfHHHW E1Hv1Hz j1jjLH(ff.@AWEAVIAUEATAUHSHFH~D9w_H4sHE:HHSHC9v2)HHTHHHHDHHH9uDMVPHHMI~蓼cIFPI~HP HEH0I~H5"IFHPHH0LLMH HאHH@0IE@8HNHE@HHHE}HH@@HHHH9HIH;L&H(LT$IDR L VLH5AUATWQPHAWLD1b+LT$HH@Mt I~L(H+DcH[]A\A]A^A_DH ^@ H-,LH*H1Ll1ɺD *H1[]A\A]A^A_DIFHmE1HH@0@8H@0H-Lj@8 H1b*j1; LH5j;*1@ATASHHHQH@@t"DHHBH8t1AHD[A\HQHtAHD[A\fHQHtHsD9fvD9fvHSH{EE1ɋJ mAąuL2k1ɺc 1H5u)uAWAVAUATUSHHDaH<$@EuOIH$ztA@IIΉD$ T$ Dt1HHIFH8t H$AD9`wf.E1hHHH,$H]H9u-ɐHI E11j1jjFH uHH9tIELCH0MuI9uD$ uAHD[]A\A]A^A_ÐAM H<$EE1LL7AąuLi1ɺ 1H5s?(ff.fUHHHWtFpVH98HEHFH@u!FP1F$E8NTHFXH]@Gau2FPF$EL1E8NTHFXH]fHt$膄Ht$FPF$tfAWH1AVAUATUSHL?Ht$I9LDtIHD$L(L9t|AGL1E1uAbf.ILtMtIuLt EuZAA9_Lv#H@HuILtMmL;l$uH[]A\A]A^A_fIEH@@HtXHHtPH9tKHZL*HiSIL1H5N&ZY1H[]A\A]A^A_HfH AWAVAUATUSHdH%(HD$HG`H@H4DHEL6LfL*L}HLHHL)AŅuL;_t]HMNAWL1H5E1m%XZHD$dH+%(HD[]A\A]A^A_DLH*HI=*M|HEPLHxIH$HI1LH~Lr~x^L}~H]PHT$LHAŅEa@LHzAŅA)@L 1bH5l$H1AVLMHgH5hL'2$^_ADLMH31LH5$#L1^H5#TL$L !H^LAV,ɹLDLe1ɺ81H5a#-AUfATUHSH8LoPDdH%(HD$(1D$ I})$)D$Eu*AHD$(dH+%(H8D[]A\A]fHHHE1jE11HjjTH Aą$tIEAHL%shDHLHx$j@T$L濄L H$LHLD11t'"Y1^1ɺxL濄L"H{H襞H=H1H5111(ftcLyE1交H5fDH&MH'bHH cu$HĝuLM9L-LH5S1E1DDH'H$sI$H@p9ChI$@oAąd1LH5щDID$@:HAUAą'HLkIH5}1GqfHIT$HHB HHHLIHSLQ @LȱHHx qLEd_M9H% DHHLIH51E1nfLJ(HHLIfLf.HA D$H@XHt[HMP1HT$H9ЅtGD$t@HE`dLHiLPILZ#DATUHdH%(HD$1HHG`H@@ua褖HtwHkLIH5F1E1 HD$dH+%(HD]A\fD蓕fLzIDHHAąHE` uw@Av+aLI?fLE1\H5o;)fDH}ttHE`tH0H}dH訔zLIH耔pLIHXL uIH51o@H L4IH51I7!ff.@8 u AVAUATI̋ AUStcH-&@d $A$9 =6HLH11[]A\A]A^HFPIHHMHHtU>#tPڃl tz ~IFPHP,6HH;LC4L[LLH]A\A]A^D=YHLM11@=)HL11A$8 =HL11iA$8 gLV1ɺH5h9@=HLl11  @Hx@P,IFP蛁xfDvfDH4%AVIAUATUS1ҾLA1ҾLD,AD tED9tzCtX ډ Љ ‰ Љ ‰!AAAALm1ɺN1H5D ؅u[]A\A]A^ÐE11A1ɺTLJH5Ձ[]A\A]A^fD+11Lm3H5OrfAUATIUHSHHHH9u/HH9t H9Xu@H[]A\A]fDHC1ɺgL-LLHHC At$HLP1XID$P ZHxuHtYf@I$@HXt_I$H(HPI$HI$H[]A\A]fD1kLL" 1 @AUHATUHSHHH9tH9ktVHH9u艎De H}HySATI1LH5XZ1H[]A\A]ËCvCH[]A\A]fDm H}I AT1ɺAUI1H5nL]3HCHHBHY^H[]A\A]AUATUSHHHHHH9t#H;uXH@urH[]A\A]1H9tfHH9uHMHLSI1H5~qXZ1H[]A\A]fHxDh HIHLSI1AUH5N~ATH 1;D1LzH5~1 ff.fATIfLHtL`LuLA\DLE1=LIH5}1fLA\HHH91E1#fD u'xLv&DHH9t"HPHPHRuуuHAH9u޸tE1Et>A9tDffI*H*^YV,t=Døf.f.AWAVAUATUSH(HFPT$ Lt$hLxD$pL$DD$,@LL$H|HILh)qIH-HxHHHHǀ`H1H)hHLpHKH1H.IHC2D$ I]MeAE D$AE$D$AE(HD$IE0D$`AE8D$pAELD$xAEP$$A$AET$A$AH$IIIIIExIIExIIIMt*MLIN`LLnHCĀtIl$`1t IL$`H(L[]A\A]A^A_HLroHIH1H IDŽ$HC T$p$DŽ$C$fLM1ɺ1H5z )f. 1E1LZH5y @IDžLLjL&M1ɺH5y1E1f 1ɺ/E1LLH5my> fIDžLLLL1ɺf.HWGLB u+BDAWML~AVAAUL-xATIUHSLHHGLHHQ1rHSG P1 H 9]L~M |$`H[HI!M|$`rEHL`DpLHAąt~AHD[]A\A]A^A_fDHL`Eur@뱐H}E1褆ALPELLP1 XZL\K1ɺ21L ffDL\L1E1'u 8ATD$vUASHGHLH@PHx7lHtRL1H HCLuHkL[]A\H@HHH H@H{藅L@IH5v11ff.HGPwpHHGhHtsSH7f.HhHt3SpPPP$H@PpHShHPhHtHH{uǸ[LI1ɺH5Pv!1[øAVAUATUHHHGPL(Ax GcHL(Aą}HLL5u+EduAHD]A\A]A^HȃAąuH)L IH5u1RHL5puLLI1HL胑dHE1调LLI1HD]A\A]A^fDsL E1I1H5tHD]A\A]A^f.ATHtuHHttHxA\wph AątADA\D1LG1ɺ6H5CtDA\f1E1.LH5 tDA\AWAVAUATUSH8H_`HH|$H\$ Ht$T$H\$D$,D$(H9xHD$ H\$HHt}H@H LHH5fsLHHsH1)HA]A^HxhtHx莽HH`0H@hHD$H``HǀHD$l$E1LtL;|$ifIHLEA9o$IGhHt|IWHL H5rLJHpH1\I_hA[A\HHxhtHx轼HH`0H@hHc`HǃIHt IHt itDT$EIGH@ IHxIG@fL7IMH@@MMLՍuFALD11H5qq=H8D[]A\A]A^A_IGH@H%8MML`TIHO Eg$t^IH@HtN@pD9tFAG$IY1ɿL I:H5p1IEg$HOfIIGHBHAwL t 1AWDE1AE;wLDL uH-pLC1ɺHLfC1ɺE1HE1hD)1҉D5ÅkAG$D)AG$uAGP)AGPD)ML;|$tHD$|$(ppt D$D$,D$H|$+t$uAą`HD$HHtH;D$tt$()P$L$Ht$HFPH9hHt$VpHxHGH@H@HHtHt$AąUMtAH HD$ tQHD$HxPLhMtH5skDL>1ɺ`1H5RkL>1ɺ]1H5,kH/LHHHmAHD$H@PHhE1ɺz1H5jNAL$>11H5jg%1ɺAL=H5oj@xLuIH5Ej1f.AUH5ATUHSHHGP_pH8nHIŅuIHLHH!E`۸EÉAąt]AHD[]A\A]fup1HAąuL=1ɺ1H5iKf1L<1ɺH5SiHD[]A\A]ÐL<1ɺ1H5#iE1PATAUHHHHH9ǸHDEpEdt,9tHHG@u$H}P…t1ADD9eptHDH]A\HTuHfuH utL@H_tHvL0IH53h1H1]A\HH#E`uaff.AWAVAUATUSHhdH%(HD$X1H,@HHHLxHAՃIG`H&Hx~H.rwHWB@H"ND9kPO@tcII9uSLIoPAƅL:1ɺ1H5gDLAƅAHD$XdH+%(HhD[]A\A]A^A_fDIGIW t8LHH@`1Ҿ8HxHL|(IG IwHSPPH@H@PA9AWHx1D)]IGI?HH9tSHtN虪uEDL91ɺhDLt91ɺu1H5efD9kPHA(DI?HW@H2HG`H5H@H菀HIGH5HP@H@`H@HcHIWIw EHAGD)FPHIuEMIHB@HHHH9{HBPL5Ҿ1ATLLUDL$AXAYDL$ E!IWHHz@Ht)G`DLHH H L71ɺ1L!L71ɺeH55d1E13HF@AOHHH{H9rLJH11QH5ƽL^_fDL,71ɺCH5q|@D)LDIG AG(DDLd$@Le~L61ɺH5f.H@@AOHt{HHtsH9tnLJH1QLH5ƼAZA[1ML1ɺH5|HL|(L !fL f@HHH9t$ t$ HHxt$ ͚AƅIG`t$ DIHSIAH9HDHB uwDBA1ҩ u HHyDDE1AąHHtQH8HhHIGPAwpDH8D)Gup9rE9gpEwDL6AƅAL41ɺ1H5a!HLt$ Dd(}oH{Ds ImoATL%`1AUt$IL1VLAVH HLlAƅHIG`HEEEHd}DCLHH\AOIWHMg HM PH}LL ظjA:ZYI IwHLH&Lh31ɺ1LHAƅvL331ɺ1H5_vL 31ɺ1H5_P1ɺ|E1L2H5X_)`LhH5._f.AWAAVHAUATUHHH@HHЋt'.A]DA\A]A^A_HBWP1LhDpAąUP1DHAąDEHDH@HLL$ЋUPA$nID$HrH-C^1ɺ1L1HE1L111H/UP1DHAąLQ11ɺ1H5]LjDr1ɋWPAątgUP1DHAąE1DLDH`AąL01ɺ1H5H]gL01ɺ1H5]:fL|01ɺ1H5\f.LL01ɺ1H5\f.L01ɺ1H5\_f.AWAAVEAUIATIUSHhHT$0DD$ dH%(H$X1HH9HD$HDHFPH5\H8`HD$HHCsL|$(HPHH {HD$,HHHD$PH$HFH|X@HHt8HLL9t%Ht LFA@ tHD$,H@fHHHH9uID$41HD$8Ll$ EMH$L$ID$`tĀt@EDHLDDPD$LLD$ 5ZYH|$ HH9D$L$ HCH@t ECLH9a|$,Ll$ >6HH@HrLD 1fDHyhHHzhHypzpQpP$PPI9HHHH9H,HHIHuL1 H5Y1E1Z@D$01LEDt$(H$VDD$L*^_uT1ɺAL-H5YRH$XdH+%(HhD[]A\A]A^A_fDAD$aA ADŽ$E|$(*DDgpEIHHHTmHsLE1LdLDAt$`LD$ LAZA[<LID$PHT$8I$Hx{D$4fDL(GAD$4S$|$0S$ISPt$0LAupQAąSt$4AD%{ImPIm`*EMHRHRL{1ɺ81H5WKL1t"HH@HHxC9kLwDd$4Iu`*fD1ɺE1L*H5UW&HCH@H Ll$ MHLrMKHAĺAuHH5WA]A^y1t$(CPLIL?*1ɺ"1H5V+CLL|$@L|$HH4@HCL|$@HH@PHxBKIHKLtJHH II4HPLH H|$@HHL8HL$HHHHHHD$HHH9u̾LH}L^FL&E1H5USLA)1ɺ61H5UE1*MALdLIH5}U1GLl$ MHLMKHAĺAuHH5=U AXAYLxuSDL-ULlLH}L]L_(11HLOH)tH-t L-T뱃F1L-TLLLTL'1ɺ1H5eT1藗fHWBtWLt H:t fHRHH9tHHtHJAt̋BLfAWAVAUATUSHH(HRH$pH|$Ht$xHD$(H$DD$HD$@dH%(H$1HHH|$(4.H|$AEHHOHIHIXHtHхHSHH$xH|$$H|$xL$0Htp<$HL$H)L$t EDDD$EvAADDCD$A A9w D$Dt EAD D$ T$ H=+L$HHH`HT$8HT$8L$HH)HHljL$THT$HHD$8GLL$8HIO*HT$H1HGD$L$TI/LL$8EwAG $`MOAG4$xAG(HCu"2(S'()9ʹBAO$1H? |$D E$h|$8T$AG@HCE'E9t'L5hQL׿1WLL$4$DHL$4$D$hHADD$0DH$`1Eo,AG0AWDCuAG$D$$ \$t|$|$L5P1LLAP1SvA]A^@H|$OP$xY&@A'Eo(E*Eo0$ \$uEg0EtmHDL58PL$Aw4H}jHAXAYLFEO0P1ɺD$8LP1AZA[$t$8|$ ؅EA_t$\$ IG`SHITpH@HHH9uHD$@;HIGX[IGPHt#HHx E1E1j111jjH 1Ҿ<HˮAG<$AG1H|$xtHD$x@pEO$D9r AO()&AO$vA)1D4&HDŽ$AG($AG$HD$xHt!HHH9øHEH$IoHeCHD$@IH&HH@HD$(L(L9#L<$I#HH!HMmL9l$(FHIUHH!HuuHR@H(IL`I9uDID$ L`I9zI$H;P@uIm HH]H9urHH9eKSLLSu1ɺ|LL%<L!L<$LVL 1ɺ1L9HD$LL=L1 Ht$@HUL5#M1ɺ< 1L LISALo 1ɺ D$ LLH5L1E1H$dH+%($H(L[]A\A]A^A_HD$HE1H-xLLHH@H@LH(s(1^LϹ_H1kLL5 L1LLm1ɺL1E1LչI$1LLRK1ɺtLL%7LL<$LQ0L/@IH"fA$AD$AD$ IEI$ID$ID$I>ID$ID$ %IVMt$ IT$(IVHIFL<$IGXMgPI_HD$HHD$L(I9}L<$L5JHl$ImIEHD$H9 HEHP@HHHH9LxLSHLHlMtQH5@Hl"IT$ HuH!H5THleHmH9l$pH5j@HTl7L<$ L.DL=IML9L<$ LuLZHC0C8L1ɺ? 1L.H|$@HH91HH9D$@u$t-AG AGAG(9vAt Eg@E"$H$HtGLƉ$HH+H$H"AG$!$MDŽ$$I~PqHHLLe HMHLHD$ H1 AnAN$AEf1EN$A~ A)D$dA^DDD$AA1҉DA1҅uAV,EtAV0HHD$@L H0LVLH91LB BIPL9D$@uI9$$DŽ$$H$H$HB'D$tH$9CL/$|$:I~Pt $$t$H$EH$Iĉ+D$dD$HIFXHD$XHDŽ$D$$$t5H$PHHAHf.HHHH9uHl$@MH9t$@f.I@MHHPI9z HJ9ztoLHr zA[HqMSH)AKIKHqI9u@IwLM9t L~;~ vH~HJHN HJ HN HHF A[HBHPI9tI@ L@H9KAD$AA@T1A<$$EPHt$ LӶ1 AF1+$Av$E~D$$AAF AFEE^HEdE^0LŝDE)LD$@1IHBI9tfDHP pHBI9uDD$| L==;LT$EVL 2L;EҿMDHQVPHt$@1EHALOAUAF  PAFPHl$@1H HAH9D\$HLE 1LASLAWLT$(ARD$(H$HHH$CHH$H D$DD$D$`D$8$EfL$8@ H|$@uHLxH9-Dl$`I_IGHD$0H91AN(D$5HD$XHI^PL H\$IL9uLfH|$t.HD$HE1I11Hx jjj6H JM$$L9d$XCIt$H9uHC@HHHH9LJHt$ L'1 IufD$;$IG LxH9D$@$ÃK I;$vAT$D . $$|$AL49 |$L$A9atk9tgt$rH$H$HLD HI9t8H>uHHHL LNDIDN$HI9uȅ" D$B4(;t$g A|$y#AN ANʉT$D$H1Av$AŅt*H$QHHFHLA9DGHH9uANDD$t AVHuI~5HD$HTM~`EDl$(E1M$H\$EAnHI$F At$LHAF0HHl$HUuEA;D$ RHJ@H HH H9 HRLT$8HLP1VRHt$@lDL$PuH LɌLT$8LIRHHLLHx`E^DDL$0HUHPhEHUH*Hhh EVHDEuA+F0CI$At$HsHJ@HSH HH H9 HRHPL1VRHt$@~DL$PsH LI}L+IEDL$0HCHI]AH ID9L$ AFAV D9u |$E~0)lj<$$DȉHH$L AFDDfDDd$8Et>\$t6H$H$HLHHtHIH9HH9uI_H\$(LcH9\$0H$D$THD$HDIAL$H$tKD\$8E$H$HHTfDHH9{L9 uID$HD$(L`H9D$0uLAHŋu$T$B ($9D9l$`OD$$D9;DD$Dl$`E$Dl$`$H\$(LcfD$|$DT$B(A9sDD)H$HL$hHT$pHHH|HHtHML9THH9uH\$(LcH9\$0o;$7fDD$$;$+AFHHLHH9HLA0HJJ<H9t,H H9uHH9ufDL ?q@$@SDT$EEN u t-HCH1LMD@$H HPt$ ߳^_uWSЃIvPH HCHMLH HPD@$t$ 茳ZY{@AutL$AHDD\$TEN$AL$EA}$qD$H1DD5AAV09B9AD$E1Ht$LLDD$TЃHL$1LL¢(Cf@($1DDD$HAUAV AVD9MAF09IfM$)IT$ AL$AIL$A[I{HQH IKA+T$ ASHqH9uHrHH9t HVD;N vH~HV H|$(IL$IT$ HV H:H~ A[D$H1DD5A2HL$LL訡{EN$A9D$H@u AF(vD$TAu;u@LAHn<$t9[D$Et EP9$$ $|$EN@D4:EX9P9DD$ERD$EL PHt$01^_Dl$`$D$fDHCHE1E1H=sP Hp@$H$H|$ L$L$TH$HDŽ$H$PH_PI>jjjH0t8S׃rEFH5$}HD[]A\A]A^A_HCPH5%DL$ H8P)I9FDL$ tLDDL$ HIEtAD9E~LLCƉD$ 莬AąEt.IAOH IHBHL fDHHH j`H9uD;|$ r!`I}AInD9|$ tAIUI1DL褪AąuL1ɺ1H5#\HK`AL1ɺ1H5W#E1 HEE1PL1H5 #XZhL1ɺ1H5"ĴBff.@AWAVAUATUSHHHHD~IͅtHAąHHt CdLHHD$L9iILHDtAą`ILHDTAąfILHD4AąlILHDAąrIhLHDAąxILHDAą~AVL1ۅuuDA9^LvgH@IHЃ8uHxLHDAąuL1ɺ1H5C!HD[]A\A]A^A_DIFH@t M6L;t$fA]HxXGcOLHDAą6L'1ɺ1H5 jVDL1ɺ1H5s ?+f.AFLD1 A9^L3H@IHЃ8uHxHtLHD6AąuL{1ɺ1H5辱LU1ɺ1H5蘱L/1ɺ1H5r^L 1ɺ1H5L8L1ɺ1H5Z&L1ɺ1H54L1ɺ1H5ڰDAVL5Lܔ AUATUHH0dH%(HD$ 1HFPHT$H|$LvH1LoXZHILt;LHq1HAHD$dH+%(u6H(D]A\A]A^DAL1L 1ifAWAVEAUAպATIUHSH H$`L$(1DD$D$XLHD$ $h$pD$dH%(H$1wHLN(H5fID$ZY H‹MpH E1Ʉt H}PjDLSD$ HPt$0AWAVDD$8IH01ɺHLHKpID$H‰t$(H t HƁHHt$0tĄ|$|$@tAAL$L$@upt$hD$hT$(HE1HH)‹D$(PDD$ Y^AŅ, AD$P|$EHt$1H覆H*LIH5%1T$hH[t'H}P^tH}PafLL1ɺfH51E1芭^DHg,E1Ʉ1DL$E D]pEC @LHHMHLDL$1HvL| HEPH5H8IH D~Et"H@ H@XHtHMP11H9Ѕ HAMHjDHAXAYq =#5=H}P HMPLL1ɺ6ILuH HHgL1ɺ91HMHDjDL$01HSAZL}A[1ɺ=HEPH8HGHtHcHHEP H8AD$@HET$pC@At$pL+uh谝uމD$L$1ɺD$L1ɺL1ODL$DAWE1AVAUIATUHSHHLvPH|$dH%(HD$81HFHHD$(HD$ HHt DE1EAH@ H#E`uHAąHT$LL7AąumHE`@@MEHLmHH@LhHAHD$8dH+%(HHD[]A\A]A^A_DL$HAL WaAUH5@L:eɺLD1E1^_@LMH1Lk]H5XLMH1LH5萖(LxtLhL1ɺ 1H5KfDHX6HHHH9OH@H@ H@XHtHMP1HT$H9Ѕt D$THL]IH51貕JDL谚L`HD$LHx{ HLLH脣HL$ 1HH3oHD$(AąHt$(H0AąHHtEduuHhXH&51H|jAąL1ɺ1H5ДhLd1ɺ1H5觔?fL<1ɺ1H5f.1E1L:~H5}HD$(@覞fDAVL+~1ɺAUL-=ATUHSFtHDvhLgPP1AVDNpLDKpAXAZAHCDHcH>f[]A\A]A^fChA$slHƒH(\(HPcHHHHShA$Ep9ǃQslChA$HƒHPcHEH(\(HHHShǃDǃH51]H;]VELL}RPHUH1P1跒H []A\A]A^DSh{lstH5\HpdHI$H9 EShKtslDKpAADAuHHt Ed"1LLT|‘1L1L]|蛑[1]A\A]A^H(\(HHHShǃShH5[fGA=ǃH5p[Hu[5ShslKtA$AHƒHPcHEH(\(HHHShfDI$A$HChDHLD$HzjDX LE=!H$Lz11JYslSh_#DA$ʉAHƒHPcHEH(\(HHHShDEpHƒHPcHEH(\(HHHShAH@XPpChHЃ{ltHcH(\(HHHHShf.EpAHƒHPcHEH(\(HHHSh@H(\(slHЃHBcHEHHHHSh@DAWAVAUATUSL$HH $L9uHE1H|$HHHdH%(H$RHFPHL$0DŽ$DŽ$HD$(HH5۷H9IDHD$@D$HB$HHD$8貑H$P$LH|$ HHCXHt6H9Ht$(H9`HPL5HH, HU`ADžu!HxHHfHD$H0HH%HItXZtSLsxMH'HH9D$0HLhHD$LD@H' HM}o oSHo[ oc0Iok@H)$PosPo{`)$`oCpo)$pooH$Ht$ )$)$)$)$)$)$)$)$7dHCxHl$HCxH$ǃ$E1H|$[HD$LrADž |$D$HMAM9ELgrADž,H$HLy[ADžn {h)|$t1ɀ|$HL.LD$P@ƃ@t$HމD$HlADžAD$d }Et|$PiH|$D$Ht$ H|$H$ZADž$L1ɺ$Ht$ H|$GlADž$t/$$H|$:2Mt$PHD$IDHHHHT$PtkHT$Pg3 DjF EtmID$`H7BDE1;D$PH|$DH(L4DL$PAEuHD$7EL\1ɺH51E1蜉@ HH9D$0ϚHD$HLhCtLHMt L$XIH|$ILoADžL1ɺ1H5RfDEHxHIWHD$IyfDH'sHxoo[Hoc ok0Ios@o{P)$PoC`oSp)$`oo)$pHo)$Ht$ )$H$)$)$)$)$)$)$_H{xX HCxE1ǃH$Hl$gL|$(HIDL$Hxj? HsXIIDL$Hx$ L4$=L56IW1L0r1LAHCXAYAZH_L1L8r趆LR1ɺ1LE1薆fDH$RdH+%(,HĨRD[]A\A]A^A_@HD$(H@L5uHDL$Hxj A[L"q[IQL1:HH9D$0/o#okos o{0oC@L)$PHocP)$`ook`)$pLospHt$ )$)$ooH$Lt$)$)$)$)$)$)$\HCxHCxH$ǃ$M)IID$`H%D$PL$tH|$8H5O/' {$LT$HH|$8H5OAD{EH|$Il$`,L`ADžH|$It$`,D= Et" TuD5^ED$0S$L@M1|$D$D$HD$HH|$Mf.S$@LE1HLpt$@I1:H5r>A[[DD$PEH|$= t  Ru5]=LMbH|$HpYHLLN1ɺIH51謂D$0H|$8H5MDSEID$PHt$L$HML$HLDŽ$LHh1 L$1H$LLD$EHcrypto_LH9$H|$LLLk${$fH-LH|$8H lL$HL$1@ L豂H$P21@ HHD$@蕂LLp$H2ID$PShL5:HH HD$H$I2$ext2$ext3$ext4$xfsH\D$`H$L$H2k.ML$I2IHHJAPLKHDƒ=1P14AYAZH$(2HlHreiserfsH9$L1LnL1ɺ71L1ɺLLW}Ht H$L/1ɺ>LAkJH51E1Y@L1ɺ1H5c/f.{$D$0DD$HEH-JH|$8HluSDHt$HBHHH9"DP(E MHHt$ H|$L#1ɺANjD$P D$0H5D$ EK D$EtqHD$(HL5dHH91LSADž H|$D$HL1AWILq1}^_ML$t{$tH|$8H8HHL.Dt$P1D t$0AL+ DE $L1ɺf ID$`H%T$0 T$PHH DT$EMtLADL1ɺY"@LHD=iEH|$LADžH|$= t   u15 D$PLGf.L̽1ɺkDHH9D$0aLpH5iI~(rMAFBHH#E`.HD$@L HtH@LH(= L5Lph1L1{@C$Hl$/fDDŽ$ HLW%H-UFH|$8H覅 C{$ AD$c %ID$PHt$H$P2H)ML$HH|$@LHD$H1Hh; Ht$@H|$11IHHD$LH5BHHR HD$LH5BHH. Ht$HHD$HDshDAt$p$D)LT$hHxIjLD A[1ɺIXLT$`DL5ILH P1APLL$PLmyHt$XAT$pCh^_AG`)‰LHHH H 'LL$@LLLENyfD1ɺLLպ1+y\$0E1 \$Ps L$H$@HL|dIH51x4@DEHICtGHD$IfM1IIH9׉DH(EH|$wf.HH9T$0 HDLiCtELHt$ LL|$OD$HH$HH$LL yHH9D$0Ho+oso{ oC0LLjH)$P)$`ok@osPLoo)$pHt$ o{`)$ooCpH$L|$)$)$)$)$)$)$)$NL$HCx$LǃL hfLL1ɺ1H5vf.1ɺE1L H5^vfL1ɺ1H5c/vf.HH9T$0_E1fDHD$(HH9,M$I$I9Ht$(ChAJTHH1HIIL9xhL511LMLT$Luapuo#LT$ok os0)$Poco{@MH)$p)$`ocPok`o)$Ht$ Losp)$o)$oH$)$)$)$)$)$LLL$DŽ$CHD$@H1MRL` H57?XtA[[L1ɺ1H5c/tf.L1ɺL1tD$ D$PL1ɺH5 1sDt$PLd1ɺ1H5sfMtLS0DL$E}{$sH|$8H}KShE1LDC QL?ADž(H5K1sǃfDH|$1$MADžCL1ɺ1H5r\$0 \$PsyfD1LLADž8L/1ɺ1H5\$0 \$Pjr-DAAIH5%H=rIHHl$`L5=1HhLH| H5<Hz| LJuHuLHl$`E1rID$PHHwDD$PEHD$AI|$ @DT$PL$L[ID$PHt$L$P2HR<ML$HLLHh1 DT$P LDT$P.vHHHD$HHL$`Hx DT$PHt.HL$`}t$P2HLDT$PuLpHD$LHx DT$PHt-AAEt$AH1LEADžUDshLH1ɺAVI1Lf<H5IpA[A^H|$8HzKShE1LDC NADž<DD$0ELOH|$H?FLL5H1ɺLIL_;1xojLt\,H5}NodP|0{$LID$`KDC 11L$LM$L9zH5|ID$PHt$H$P2HML$HHLHh1 R1H$H$H1 $DLLl[1IH571n$t$H11M$02LL(\mA[Xf$ex$tH7D$`H$H% LML#H|$11LLޮ1ɺH5R#mLL$@L`L5+1LlLLqYIH51l)H$P2@ 1IHHD$@mLLZL5$RID$PShL5HH HD$X$R! $P2ext2G$P2ext3L|$@H5{7Lv(H5i7LpvH|$@H5o7WvlLL_k1ɺLL@fH|$(1L5M1ɺLL]k-rD$0S$LD$XH|$HLH$P2SADžL7KDC 11L$LI $ML$HL^AL5H9D$Ht$L5wHGH5AHCIHt$D$HL$$D$HHt$PHxLjDH HD$ L\$ H$82HD$xAI{H Mш$A$$E Y^t$hILL$=LX11ARi_AXD$EH|$8H54snD$` HreiserfsH9$ML&YL1i1ML$I2IHHX3HDƒ=LH1H$(RAPL\WP1hH L[L3IH51hKDC 11L$LGI$;yLU1OH5Y%hL1ɺH50$02H)T$HL=NLL$HLUH11R,gXZL5LR1ɺLgL21H5rg\$0 \$P-LHl$`AhxLL6KIH5T1gLLe6hIH5 1f$T2H11g$pRLL$PLL2fAZA[f$P2exiA$R"L*$RLIHH0HDAP=L1t1PLL$P1.fAXAYEH|$8H5pu3L{4H51Lyp $R$$R{ $RL=0߈$Rƒd$ @ n $RuH|$8H5os $R{HL /LD$RLDʄ%IH /H/ uH @H/HHDPH=Z1AWHt$P;ZYL9D9rH$P2HxHHItHtHLH)H)HkE1Z$3`$pRH)T$XL)OHt$X=eAWR1I1L`XZ=;LLPL11`$H2$H2f%f=tv$H2@ $H2$I2=dLL+11+`TL$@2L9L$HH|$8H5+j= ,PL1ɺM1L_Lf1ɺX1L_ID$PHHt_:#tZH|$=yt u,= ID$PHtP,tHx@P,]XID$PHH|$肄IHL$HH|$LLLC4ID$PH|$H>.H|$1ҀID$PHYHt$@1Lpr H$(2L$hRL9L$HARL1t$PL_QR^A[L[1ɺL12^cE1$R2t=xLSL11Ƀ]$RO=GL SL11Ƀ]$R=LML11]{u$H2 $H2t @$H2$H2H|$8H5ʆD$h$H2gHS4ARL NLRLL$H51]A[[%=mLRL11\bL1ɺX1H5\GLLN\HL$Hf1L$H)$L H$82H$HH|$@  1譵 zH=HH|$H$H$L$H$HIH$HHH$HD$@HDŽ$H$HԄH$LMH5s[$T2@MLAKL1:[N$RL=%l=LPL11ZiML1hH5|Zw=/L3"cL11ZS=L!_L11Z=L!]L11ɃXZ$H2=L=LAL11'ZP$LHL1Y 1ɺrLL~Y1ɺoLL^Yd= L aL11Y#$T2$RL=$RH5Lc$Rsp$RHHH5$HT$pcHT$pD$`|$hD$h@D$h <$I2=.LWJEL11X{D$`$H2H$H5L #L#H #HD$I2WH=JLDȄLI VLHDȀ@H"HD1G/AXAY H5 1FXZ[fAWLAVAUAATUS1HHLVPdH%(H$1L9HEMAABaDHEAHM`2NH!H"H&5H'*H.H/HH$IHH$AA,@IHT$ Ht$DD$H|$Ht*LT$(HL$&HL$LT$(HD$H4H%EiH-zH4Ht K(`H<$H$HLT$H3HHH9ǸHD1IH\$LT$" LHL9LT$fM?I9IGHxGft>u݉$IGHx-1L4DIHt$1XDD$QfML;1H5%DL1ɺ1H58DE1H$dH+%(HD[]A\A]A^A_DHxLgBI@H5ӱ1CE1H8LAIfHLAIfHLAIfL@H5dCfH訿L@I/H耿L@IH_LAIL9@THH- 1HDH$HHt$HDD$HT$ ElHH%HEHD$HFPHt$HHLT$ HL$#HL$LT$ {Ht$LLT$HHM`LT$GLT$HHE`t H$nH4 H-s H;HLT$LT$HHD8EH@LT$H1ɺ^L ApHHt$1LbA AAXHAY:LT$H<$LLT$l"LT$LLT$bH$LT$Ht*@d H<$LT$LT$H|$HtL$L$] HEPHHt^L$j!L$tMHHL;L$u.H˼L281ɺIHt$1?L$HuHLHU L$H  tEL$u{D tvE7 HH 7H@L@HHl$01L$HN@H L$AB, =Ht$ILZ11V?AJDHLT${HM`LT$HHHD$=HH{L9rHPBdHHzHt GczHLT$LhLH8LT$ HLT$LT$+H4LT$AEDDLLLT$HM`LT$LT$H1ɿuHHt$1L ΢L_>^>AZHA[y7BLT$E1HI9 dOHH9}mHt H$iHHt 8NHLT$xLT$4$L1ɺH5}1G=D$=HFPHt$HH|$HLT$HL$1HL$LT$Ht$HLHD$HM`LT$XH5LLT$賯LT$HHCHH@@pCLCPC$EpZHLT$d+LT$HtHPHR H$HE`I|$H5(4LT$H|$ FLT$tH|$ H5 4FLT$Ht$ 1L$AJ,kL3;L$ML9eMHHD$H$@d H<$LT$LT$A.H<$LT$=)L:IHz1HD$Hƃ1<;H$LT$SHLT$迷Ht$1L2I71:Ht Ed/Lu|1ɺ01H5~}:LT|1ɺ:Ht$1:E1H$6L2IH51_:D$UHLT$褩LT$AL{1ɺmz$L{1ɺHL tH@H@HHbPHt$LH:19^E1_HD$kL,9I2HLT$(LT$HHxLT$;LT$$L{1ɺXHt$1L9D$BHHLT$ H9JHhH|$HD$葞H|$LT$ 赭H|$LT$ AEHt$DLLT$HM`LT$VHEHL \$L8z1ɺ/LMHL71LT$H5^8HM`LT$HL!7IHǴLH.jIH5X17LT$AH<$LT$腴Ht$v=,ILX71Ƀ17LT$ HLT$EL-jIH51p7LT$HxLT$yHE`LT$$Lx1ɺLT$ H|$xLT$ H|$AHD$LL LHPHL HH PjLT$(ZYL$H|$pL.1ɺ|IHLT$HLT$LH tPHE`LT$D$L5IL$L- IH$L 6>ILw1ɺH5 5E1IzHL$S L$HHtIzIxgIL;w1ɺLEHH UHt$K1L5\5E1S?H<$L,&IH<$ֱHt$L5Is15E1H|$$螱Lf,Ie$Lpv1ɺIdHt$LXv1ɺU4E1ff.AWAVIAUAATAUHSHXdH%(HD$H1uHHtL~`I$vEEAFcIDLBADžLOHHt LH}1ɺHIL513AL$DHIHpADž'ELύtSL+DDLHADžxAHD$HdH+%(*HXD[]A\A]A^A_@L`uAIF`H%@H-II9upIIH9nDHHH* IH9IDHHxHHIF`H(sqEulINPHHH9tUHfHH9t8HPHH#Z`tL賮H=4H1 +HH5HHAL$pHE11jHjjjjQjjjLL$xTHP1ɺ9!HLrbHE111LHlHHKHEHHKPHEHH(AD$pHCpHHChHAH@@au/H-9Lm1E1XDHAWxH9A(M HD$D$,E1H @HD$I_XHHH|HsH@HD$HaIH@@U ZLs$MAEe H}H5/HD$HsHD$H@ u%AuA9dMt  MH Ht$HLDALA%IH%ED;Hxt(DHxLE!1 $H5~HHH\$H#CuLAGxDEOHIN`L! A$H5^~EN|P1#AXAYHLeHckL 1 H5LsQ1ɺ$H5}1IEOpH1H9o H1@HH9uA91f.H6H9uA ApAtHEHDL$Hxju AZA[IL# 9L#LHD$IH@:=65AGDIH@@HeAZIWXHL HHHT$HT$HHXHHCPHHtWtN1HHLu6AS AwXLL%H5 []fIdž DII] HD$EEIH@H){AH{EAOtAWpASAPWLVHt$0E"]H :HD$@t EWEH}EzD֣Et uyMtHD$@ IF`H-H h H%Mt  1L賞 E_EtHD$@ AW,IF`2INPH H*AO0IF`tHIF`Aw4 LtAG4HyHyI@BA3L%y1ɿ1LLQq% ILIFPHHtNktEH|$ HL>u(L҇1ɺ&LIL,1 IvHI IV HۦHD$ H5mHxAt-LEt!HItHMDLL1E1&} IIHL$H9$H@@@u1LL]tIn`+Eg(EtIn`,IHP $IF`H-H$HD$Ht @dBIIH97HH9AW4H|$ L&9t$,fAWDIH9D$H@@@uNLLt:AGDAO11LPAPEEG A\Z IH@H*  H|$t AFe  EE;L;H|$ H^JIFPH8v=t u]u5AMAuIf`H|$H|$AOxLWpAH H AW4Ht$H|$ OH|$蝄L&IfDAHEO| fII9L#L Dt$4L HlAT#LlELDH5Xu1"AYAZfH*DL@uAG4AEd 2 L辯LRH1ɺ$IIAwxAAH9ǸMMHDhL%|tLG1ɺ%L7fLG1ɺi%TDH|$.Z1H\$AGxH9ChPHD$H@ DDEA~pL L1ɺ#1H5sIGzH$AIIH9vHyXF GAAW|HuHH9H9HDH~)L$HjHk Y=I^L11H5sA_|AGIL~1ɺ$H5rLH(1HHL$GD$,E1EI1H$E1PL^1H5'rXZDHHr e AG42)H|$ L'LGL%IL%q1Lo IHIH9HCH@MII9ID$I|$@HHH9%1HHH9BH9uDJALo 1EH5 DL$DL$DEpI$HHD$Ht @d`11LḪHt$HLjE11LLJ1ɺD%E1LCH5/pSL%pL: 1#L@H}H5ptHD$H1ɺ$E1L7CH5oIIH9HT9s`D1HHDH1HHID9t>=EѺ6$HLP 1PH58o1EA[A^EWEaID$,HXIIA@LH9ǸHD111ɺ%E1L)BH5nzDLxj1ɺ]$E1LAH5mn>fIIH9UHWHB H%oAGH|$HD$$Lf@cH|$~mAWxAH_| H|$ H5l6qHD$HHL$IGH|$ L5(AW,Aw4MIAG1ɺ%Lz1ɺl%1H5jL$1H5kgi1ɺH%E1L=H5oj@H*=EE H}H5joHD$HHL$AGH|$Ht$LSIHsII1AAAwxH9MMHD+]1LML%iLk1ɺ>&LLIH92 HLLx蕅 LL LH|$ IFPH8Bh ԑt ug`LH|$ H2:LBwLLI&1obMILI設AFeLH|$ HpLvL&IfLv)$LILO(H1LY$AQH5gA_XLAvLjIH51jA H*H,H|$ LIF`Yx Iv`,L1ɺ%1H59gpA1ۉG@AGDjEWEHIL 1 H5|L,:1ɺ$1H5foAG4H|$ LgwLtLh %IHIL,c$HML#$LLOIHL%e1ɺ-&1LO9Lf.QL1RL$E1H5e`AZA[H)2H5mHCH-I AL H!LL&LDL%e1L1ɺk$E1Lb8H5d1ɺ~$E1L;8H5dAW4H|$ LLsL&I_H,H|$ LIF`YuL%TdL+ %LL[um\$,EÉD$,IEPHHt*t!H|$ HyL͟ H|$ LtL[| AEd >LxL 71ɺ%rIEPLH8HD$8etHT$8LJ" HD$8HPH8L2W IH9HLI9o qSLAVI+H5 1_AXLX61ɺE$fHHHH9L9HYHt$H|$ :~` Ht$H|$ S( AEd  1L&gL51ɺ% L9E1I$H5b61ɺ9&E1Lk5H5aL%aLL51ɺ&LLH|$ H  IEPHHzH|$ H!LI%E1L1H5=aaIXALHνo1ɺ HILk1IW`HHHT$蛐HT$HHpH{HFPHt$HHHt$1H LtRHL&Aw`L 4Y^VHuIXAGLB1 H5ѼL%*HLVtL%'HL@(M LTnN$LIpL1ɺ$1H5_jEL%_MNHLI%LXHIHkHU`MDHLHHHDIHdeDIEHHHE`HUPHLlIHLHHE(u==&vLW&H5R11[L]A\A]A^fD1L/1ɺ&H5Rg[L]A\A]A^H?H5D'IWHIHMDDu4HLE4HU`IHDu4L%1ɺ&1H5R@f.{`&LIH5Q1E1@LK(&LLB1&H5Q]L$1ɺ&1H5kQ7L$1ɺ&1H5EQrL$1ɺ&1H5QLL$1ɺ&1H5P&L\$1ɺ&1H5PL6$1ɺ&1H5Py@HG`@ AUATIUSH~I$IH]L9u HLL+I9tvHtHEH;CuH@ H@0HtHHЅtHHCHHBHf.HtH@H@`@u ^H[]A\A]ff.AVAUIATUSHGHHPHk8EL%qk<&k@kD$H{HG`H=r {HHSHB HHHHH{HDcHe]HLIH;UATH5NP1AEH PAUdH{HG`HH[]A\A]A^HSHB HHHHHH{L%\UwIHzLPL1AEY^PAUdyk8}HSHB HHHHЋk8IHSHB HHH{HЋIH{ \H{LLIATH2UH5P1&AEH PAUdk<fDLr(H{[HyLIHAVLUP1AEH PAUdQrfDH"HP HYHHMHHH{L%ZUL LIuHP1AE_AXPAUdDHSHB H?HH3HЋkLJH1ɺPLH51N_AX_L >ML >8%I$HtdL9t_LJH1ɿPH-1LHYL^1ɺHLeL q>f.AWL=uAVAAUE1ATIU1SHh._}Cըtv:fDAtfH1AATL#LE1AXZLH9s4AHHPq:t:DDfDHD[]A\A]A^A_fDHLAATLP1E1Y^oDAWIAVE1AUL-+ATUSH8HdH%(HD$(1HD$$H$H92fDAAGbQHC@ AGf HHD H H#P`EIW`H0@fH{HH9t2HB L HP2IGPsTH8i EH{HCGgHUHP HUHHIHH{IFHL8IHATLP1AVD$DPT$DH d-HH{HCGgHP H*,HH,HH{H,FHLIH:UPAV@D`E0HIW`HT1H-aDHHCEDLE'HPtvHP HtHHt HHHh(H{yEHLIHUPL1AVD$DPT$DH dHCHXtvHP HtHHt HHHh(H{DHLiIH,UPL1AVD$DPT$DH d_HCH{GgHSHju AGfH@H"@bu{HB HHHHHH{8DHLIHUPL1AVVD$DPT$DH dHHHtHH9t H9txHCHP HHHHHH{CHLIHUPL1AVD$DPT$DH dHSHjjLcH5L$HT$I|$H~HT$L$H&A!HB HQ"HHE"HLcH8"HP Ht HH^Hh(H{BHLIH2UuPAV1LD$DPT$DH dd@{LE1uHLIHeUPAV1LpD$DPT$DH dHHHHtHH9t XH9HCHP HVHHJHHAHt$$HlkLHSHBHHttHB HuHHiHHH{K=HLIHUPAV1LiD$DPT$DH dHC@IW`H%%H$svHCHP HtHHt HHHh(H{Hj(Hh(H{_-HLIHUPAVHj(H{*-UIHLPL-1ND$4PT$4AZHSA[dHCxH9CxY{L1E1Dt$L|$AEHD(D`pE9PHB HHHHHHHD(D`pH{HT$_,HLHT$IHjLR3ATP1xD$DPT$DH dCLAHSA9DHH,IHH (9t|HB HHHHIH{+ATLI.HLP1ڮD$4PT$4Y^dHHSH (HIAdEHAHD(DppCLA92HDt$L|$H.&D$1L$@IJ4!( 7 HB H HH HIH{*AT@LIHLP1ڭD$4PT$4AZHSA[d HjDHB H|HHttHIH{:*AT0LIH\L=P1]D$4PT$4A\ZdHHSfDLb(Lb(HR([HP HtHHtHH{HHh()HLIH}UPAV1L辬D$DPT$DH dHB HtHHt HHHj(H{))HLIHUPAV1LGD$DPT$DH dHSHjL`(H{(HL5IHmATLP1AVD$DPT$DH dR%HSDt$L|$HjHB HGHH;HHH{4(ULIHL8P1XD$4PT$4^HS_d{HB HmHHaHH{HTHP HHHHHH{'HLIHUPL1AV質D$DPT$DH dIW`^HCHP H0HH$HHH{'HLIHAUPAVHP HHHHHH{&HL2IH(UPL1AVD$DPT$DH d(HCvHj(f&HLIHUPL1AV脩D$DPT$DH dHSHj(Hj(Hh(Hh(QHh(HB .@uHHu 3uHLk8UEt{HCHP H[HHOHҋk8IH{S%HLIHjATLUP1qD$DPT$DH dmHt$$H|kHv'H{HCGg ?HWPHCDcLHPD@ HHA Dt$1|HB HHHHIH{V$ATLpIHCPL1yD$4PT$4Y^d;kLqL$@HIL8t}HCHP H HH HIH{#AVLIHzLP1D$4PT$4AYAZd HLHxGatHC@e? HSHB5*HHL8HSBeHx%HCHP HVHHJHIH{"ATLIHPvHP H HH HH HP Hv HHj HHa IHt(H;<$t"{<HtxLuH8uL9xt HHH{ !H L|IHUPL1AV*D$DPT$DH drHCHP HHHHHHj(L HLIHUPAVYHR(HKHLDLIHRPj@1L{D$DPT$DHSH d\Hh(H{HLmIH3UPAVHJD @pD$;kLHHF@dt$tJD!Hp9tHB Ht!HHtHHHJD HpHR(H{HT$L$HHLLHT$ IHwRL$ HQP1^D$DPT$DHSH d0DLb(HP H HHHHH{HL%IHUPL1AVӡD$DPT$DH dIW`HCH%BHP H[HHOHHH{.HLIHUPL1AVLD$DPT$DH dHCHP HHHHHH{HL!IHUPL1AVϠD$DPT$DH dHC.H@HHH9tHtn7H9-HSHB HtHHt HHHj(H{ HLyIHwUPAVI;D$hHB H HH HLcHLHLIH-UPAVyHB HtHHt HHHj(H{WULwLIH?P1{D$4HSAXAYAHh(HJ HtH Ht HH‹CLHR(HKHLLIHR"Pj@Hh(Hh(fHP HtHHt HHHh(H{HLIH_UPL1AV謞D$DPT$DH dHCOHP HtHHt HHHh(H{HLIHUPAV1L1D$DPT$DH dyHCHh(HB HtHHt HHHR(H{HT$HT$LIHLREP1詝D$4PT$4AXAYd%HHSHh(%Hh(Hh(HB HHHHHHh(HP HHHsHHH{H L-IHUPL1AVۜD$DPT$DH d#HShHCHJ`HP HHHHHH{8HLIHU8PAV1LVD$DPT$DH dHP HHHHHH{HL/IHxUPAVMOH1LhH5进D$$PT$$dH@Hx`JHCHP Hd HHX HHH{HLIHU#PAVHh( Hh(MHh(Hh( Hh(QHh(H{H(L'IHXUPL1AV՚D$DPT$DH dHCHh(Hh(Hj(H{EUIHLPLH1iHSD$4XYHjiHh(H{HLhIH'UPL1AVD$DPT$DH d#YIٹLEH5ԙD$$PT$$d~MOH1LlH5_蓙D$$PIL댐Lp(QHCHP HHHtyHHH{HT$HT$LIHLRP1D$4PT$4_AXd=HSDt$HjLb(HP(HP H_HHSHHH{HHWLIH~UPL1AVfD$DPT$DH dHCHPFHG`2HP HHHHHH{HL.IHUAPAV1LܗD$DPT$DH d$HCqHP HHHHHH{AH=LIH*UPL1AV_D$DPT$DH dHCHCHP HHHHHH{HL0IHCU%PAVL`(HP HtJHHtBHHH{mHLݸIHoU?PAVHh(uHh(HCHP H\HHPHHH{UIHǑLPL 1,D$4PT$4ZYd*k87+fDHh(]AHP HHHvHҋkLIH{pHLIHATUPL1莕D$DkLH Ht$$H萼kLL`(Hj(WHh(Hh(+ OAC<7HCHP HHHHHH{Dc<LIPH5UATP1fDHB HtjHHtbHHH{VUZIHLPLY1zD$4PT$4A[]dwL`(Hj(Hh(HHP HHHHDcLHH{LIPHGULATP1D$DPT$DH dHP HHHHDcLHH{PHLIHUATPHh(HP HHHHҋkHH{IHL2IHATUP1LD$DPT$DH dHP HtJHHtBHҋkHH{I~HLIH1ATUPL`(YL`(HB HtiHHtaHHH{(ULIH.L,P1LD$4PT$4^_dPEHh(Hj(Hh(Hh({Hh(YfAWAVAUIATUSH(HdH%(HD$1HD$HD$H9?D$1L=hD$D$L9k1HMMHLPLs1DufAXAYd9S D$9tDHMMHLRLfPD$P1E^H AdpEHSK$sPCLz9tQ)9tHHMMHLIVLQD$P1辐E^H AdHSEBtHCpHt H;CX2{L1HL$@ILHz=HIEPH9GPI9HHH961@1H9XHH9ut@D$LOHLPAuH1LÏXE^ZAdEރ9kL,D$C$DD$HH;\$AUpE9tJDt$MMHL]RH5"*P1ND\$AXAYAAdD$~MIL9 L5ωI\$HCSLLHMH4RM1I HH1AA8HHtEtMuL9l'HH9y<uL9lu빐UD$ MMHLVPUD$ LLMMHP16AZE^XAdHEJ| Ht H9_ UD$ MMHLPHGHMMHLLIAQPPD$P1词E^H Ad1EHT$dH+%(DH([]A\A]A^A_f9o(fApHD$ LMMHLP1.YE^^AdE1L9L9L9L9h1L9AtL9kX<L9/HKAD$9tYHs MMHD\$ RS$L߶RTVqHP1LcD\$4H0ACAdAHKHHH9u DHH9H9uM$$I9IIH9VL%if.IH9xhtFMMHD\$LfoAQpH1L襋D\$Y^ACAdAHH9HS:HBuHHtHH9t IH9z`tMMHD\$LAwAQpHv=S C$D\$HLIHAuHLWLP1RdD\$$H ACAdA(DHQHC$D\$HK MMHLAQRPQRMGpuYHHHT$H5̌E1ۃutMMHL111D\$H5*D\$E{PLOH*1jLH5XAZMMH31LH5踉AI}HHT$D\$H5ǨD\$1MMH13LèD\$H5XD\$ACAdA訓HS=@tlA'AtA uHfDAt1La1ɺH52HHfDUSHHtiHHnH_HHHFHH0HHH}hH9tHtCHt HGH@PhH]hH[]9 ff.ATUHSHH0HdH%(HD$(1HFIHBHHFD$ HWLoHp@)$oH)L$HRHRXHIHt!HpHC LH@H@XHxHCHmH@H}hH@XHXH9tHtCHt HGH@PhH]hHD$(dH+%(u H0[]A\莑ff.AVIAUIATA1UHLSH?HHIIH9uHH9HSH9B@uL`t[1]A\A]A^fDH`uHL\HHHCA)A+A+[]A\A]A^@Eu[H}1LHHtAHHH9u,@HH9t HJH9A@u[]A\A]A^HAM1L$H5.nX1Z[]A\A]A^ÐAVIAUATLUSHI9EL1ۅu@9]LH@HHЃ8uH@H@H@@HtUHHtMH9tHHRIvI>1AŅu1Li1ɺH5 .讄[D]A\A]A^fHYHmL9IA[]DA\A]A^ÐATUHSHHHdH%(H$10AąH1ULhHa@LH肐=K@XZu/AH$dH+%(HĠD[]A\HHxIٹ1LH5,蒃럍@A,HHcH>fL91H5SL@IL1E1H5t,(fLu1H5f.ALK1H5趂iLٮ1H5茂?Li1H5c\E1LH570薌fDAWAVAUATUHSHHH_HGH9t:f.HCH@0HtHHAąH}HHGH9uLPLPAL5*M9u*H}1HZrM?M9I_uHC@HH5HH)H9 LJH1LQLV1ɺHEH{@H@HH8HCpY^HЗPHC@HtHHt H9L LZL1E1褀M?M9"H$HEH0H:"LEL1L 2HD[]A\A]A^A_L @HC@HHHHH9LJH1LQL5E1XZ2@LJH#HEH0HQL=LL11KA1ɺLL%LEL !@L-J(11 LL~L1LL;~~LL1ɺ1L~ff.AUIATUHSHHdH%(HD$1HHt$tP$9Er@A A;w\HD$dH+%(HD[]A\A]f.EAL11H5/'}fHtKHHtCH9t>HRRME1PL1H5&}XZWH9fAUATAUSHdH%(HD$Hu"HD$dH+%(HD[]A\A]HHHtH5OptHHAH9tL--&f.HH9tHCuHx@H菓tHKH$HH9sHI@Ht>H1Ht6H9t1LNRLժ1PL1E1[|XZL 貆fAW LڛAVAUIATL%j%ULHSHLdH%(H$1D$\{HVD$@HLD$DL|$HI9t_Lt$THCD$TD$XHx@Ht-Ht$XL&tD$TtL$@9QHL9uD$DHL$\IIHL$HL$THL$ HL$XHD$0HL$(H9r@HCHH@@H@HH4H9+LJH1+LQL zXHCHZHT$Hx@KHCHT$ D$THt$(D$XHx@t$@t\D$T9tTtPHUuD|$DEHL21LPDL$P<1zA]A^f.L{IG@HOHHCH9:LrLmHEHM1ɺ=LHD$L,1Ll$yAXLAY(y IHfH@ @IOpHt&HϺHL$H5|HL$HMFQLߨL1yY^HCHH@@HHHH9LJHE1LQLjE1xXZ6L i@L5Y@L8!PH $IG`H;At|HMp(L~V*@HCH@@Ht;HHt3H9t.LJL1ɺ81L濄 xL =t#IG@HtHx8F LLLL$8|H|$HPHHT$ HHT$Ht$8H莅HLIGpoAOxoAIAH$ALJHxHGPPH}1LHHH|$HHH9HHH94HrH9F@uLl$`@LLHMAULslfDMLfL1AevOMLFL1P=v'L̷1ɺM1LvfDI@H,s1HML@]MwLLauf.H|$HfH H9t8HqHHFI3I3GH uHVHFI3WI3GH H H9uȋt ;H|$L}#vAHH9M}LHXAH$H@HHXHHfHPHHI9H9uHH;\$0HAHt$0H[% H$dH+%(HĸD[]A\A]A^A_AHCH@@HHHH9LJ0L1Ls{fDIGpML1cLsL\1ɺ 1LE1s 1ɺLL%}sD$`L )I@L t@HD$@L9HLE1PDL$P>1LXsAZA[D$DHMLjL.P1rH HVHPH1ɺLL<r~PMLMH9|ff.AUATUSHHHGH@@`ItfH.wH{LhL HLLHH{H HTWAŅAHD[]A\A]DH L H+I9uHEHI9tHHsL|uHHCHBHѐ1rE1LLcH5BqHD[]A\A]@H1MxE1LhH5RpXZ"DHM1}H5LpY^AUIATIH5USӺHHstAD$`t4AHD[]A\A]AtBI9X t6AL1E1H5IovAL'DALl1H5E1oHD[]A\A]AL1E1H5fo=AٺLB11H52o:ff.fATUHSHH6{ LmtfCLtNHEh@`tA[]DA\HSHCHu{HCHt~H=vLw1E1H5onD[]A\AL11ɺH5g@ATt*HHH9tHPHHb`H9u1H5AątADA\1Lb1ɺ1H5\DA\ÐATUHSHH0dH%(HD$(1xD$ t`Ht:HLKHYLD$ H5P1:\D$EXZHD$(dH+%(vH0[]A\@HGPHxOY^HD$XLf1ɺ zHGff.AWHAVAUIATAUSHHH9t!D] A9r M$ A9rEHmH9uHAuHE1E1L6H58">XZqA9_H}GHLM0DE(HuPPETPPEPPELPE8P)/HPIH HIEPHHx#DHUuL)ىBA)FPD)E1EPA^$M$M AN tHDHMH@HHIًA)AD;}LrHEHII}PInLpLuRAąu+Lw~1ɺ1H57<AHD[]A\A]A^A_HBuPELLL$PHx)pLL$IAH:IHDHHHDH@H@@HHHsH9jHBHMMHLQPATAWE PfDE1H-6LH;LZ}1ɺ1HE1;fMPJE1DHRL0(IHMMHL~DPHHDpHATAWE PH551!;H0HG I]HHt_HHtWHISH-51ATHL}:Y^f1IHiLO(H-Y5L}1Hw:H-5L}HM:H-5L{1ɺH&:cH-4L{1ɺH9UHAVAUATSHL&dH%(HE1L9ILE1DHAH9uEDHHHBHHHHH)H9tHH$H9u%H)HtHLLL$1IL04IL9tIT$M$$HHPI9uIIH9-EDDLL{ HUdH+%(u He[A\A]A^]DH1HHL9tIH@ tLHpIqLH<$Ht$LHpHD$HHH1HT$HL9uH $HHL9tGf.HqIHpHHHw LHqHO HLHHW LM9uH_L9E1L-f.H}AHHGH9tLC uHCH@ HtHHЅuͿ1Ln1ɺO L,H}HHGH9uHEEu7HE1HT$dH+%(H []A\A]A^fHHHHDžH9tHPHH!H9uH}@bHEHHEHHE@E,E,tgHxLxL-rL5 L9t4DLKML=br 11+HL9uрe,LLxH .$H5qH=qV.6ATLUHSHL9u ?HL9t7HCtH HpHHP HDHCHL9uH}HaH}HEHH_HGH9t_L%ifDH}HHGH9t@HCH@(HtHHЅuLl1ɺ 1L*[]A\ff.AUATI1UHSHHXdH%(HD$HHGHLhHHPXHt HRHHxhHH{@^HHH>u%HD$HdH+%(HX[]A\A]fDH@HC@HWHHKH9BLjHEHHH- H@DL$Hxjg 1ɺHI1L,$Lqc)A$HZHYH9HC@HHHH9LJHD$HdH+%(1ɺ HLp0fDHH4H9+H@H1ɺ PLpH51M$(H{@^AXHKHLfH@HH=tIMtAI 1LpoH5z(HC@D$f.Ht HHtH9unL HD$HdH+%(LaGH5HX1[]A\A]'DHY@L-I@LJf.L )O@I$HHtI$1AIL3n11H5d 'o1ff.@AVAUATUSLn`IEHh8HIHt5LHLAąHA[D]A\A]A^@LvpMt)H5kL)utL5M1E1LnAH54&[D]A\A]A^1Lg1ɺGH5Z%[D]A\A]A^51E1LmH5$%$@ATUSHHHE1uuID[]A\ÐGauL1LH5AY%t@C`u1A LLmH5q%}fDL"1H5GA$HHATUHS>toIHHtR3/tW&LBHt7HX Hu',fuH{?t H.tH[Htu[1]A\[]A\fDfH9wAVAUATIUSHHtFI$M$L9t9fDLmI}hH9tHtCHt HGH@PhI]hHmL9uI$PM$PL9t;LmI}hH9tHtCHt HGH@PhI]hHmL9uI|$Ht HGH@PhI\$[]A\A]A^f.ff.@AUATUSHLg8ML%AHHӹL8'1J<#H)DHk| tFL'LDhDo H}8LD L MtMd$HL[]A\A]H-1ɺ1HL)dE1y"H11Ld0\"HL[]A\A]fDLc1ɺ,1H5'"qfATUHSHH IHthooKHoS P o[0X0HC@ID$@HCH@8HtHsHtHID$Ht@Md$M$$L[]A\LAj1cH5t!fLHE1B AUATUSHHLoG C HCE1HPHHt LIHCHP@HHtLATL PHLi LDH5!1 XZH[]A\A]utmHAWAVAUATUSHHHGPHh@Ht-H}pt>HH#HH[]A\A]A^A_HH[]A\A]A^A_fD(#IH-L@H@H@ HEpHHD$L9oE1L=$IN LHq K LepAt$IT$LL$HEpHHBHH!H'LahSI1H5EXZHH[]A\A]A^A_ÐE9,$uL1ɺ#1L M6L;t$LepE,$"f1HEprATUHHtPH5HA;)t+H5H()tH5HE1)AHD]A\ÐE1HD]A\fAWL?1ɺ AVAUATL%ULHSHoodH%(H$1LHHD$1Ƅ$)L$`)$)T$pHHHLI9H$L= HL9thLsI HtL(uL$H}LHHM p HCH HH4$L9uDHLHI9fDHPHRHL9uH,$E1Af.L}`HL9t4HCHhHA!H}`uMu1~+IfH,$E;LIM9u/'HxHIL9HIGHP<tHOrHLP$ Le=L11IGZYHt D8EwL]1ɺ1H5Lj]1ɺ( 1LL1L L?eH$dH+%(HD[]A\A]A^A_fDHE_ L1L9e'E`LLM9L1ɐHPHHHL9utHE L5L M9WIxLLLWfDHBHHHL1L1H HOHGH3NH3FH H}1Ҿ9Aƅ4HHH9tIHNHHH9u@HH9tHPHzyHE ? H}DdHGHwH9HE1fDJ HAH9uEHO(HW(AH9HE1ɐH?AH9uH9HE1DH?AH9uEE9>E9E)H9HE1DO H?AAAH9u1H9t HH9uH9t1H H9uAVL1 APLNLWARDT$ H ED$HEH}DDD$HGD$HIH}HGHWH9L,$HEHfDHmHGH9E uADDA# t;HHT$AHT$:HzfD L1LaH0AƅLQY1ɺ 1L H6H9THL9MM9M9DL LpaL1)E1En1fDP HH9uWLuA E`uH}@HtIAƅ7ḐE H} D Et ڧLE(LHM9tHH\$PfD$PIvI9HfDHL9H;puM6M9uHII9u,fDIEIUIHBHHL9HIuH}uLuW1LAƺ ,E1EHO(HW(H9 HE1H?AH9uH9t1DH H9uAEHLV1ɺ1L/LV1ɺ 1LE11H9tHH9u1H9tfDH H9uD)4H菭 du DždHuHFHH9L`L1E1 zDH~`HHGP@DD$PEH}(.w HfH@ @IVHHP) HL8HHHHHHHB@HtQHHtIH9tDLJHL濄1QLa1ɺ ^H_n@H^L E뷹 LAL\bH6H9H}E1L$H_HGH9C 6HCH@xHHIHHfod$`fol$pƄ$LA)eA)mLP։$P $H=֣L HHtLHPHtC1IH$H$Ht(t;DHCH@HH}HHЅHEC L11L{` LK H}fDHHGH9EZLoL9t;fDAE u!IEH@HtLHЅH}MmHGI9uHAIHHt@L9t;H@RDM( 1PLL_1L濄5XZH}AAHڂLz11 LH}L L:[HD$PLoH$HD$HD$PLHD$XHD$Ƅ$oxHt$ )$)$;HHLx H L9tjLMIIfH@IVhH|$PHP2HT$XHt$HPHT$XH0HM6HD$XI9tIr HuMHD$PHt$LHD$H;D$Ll$8IHl$(HD$Ht$ LhHD$(HqHHP H H9tL;jhYHH9uf1IHt L;hh{MWIEHJL9ALHU L1L\ HD$HHD$H;D$8Ll$8Hl$(HHt$ 譜IHUHx I HL9DSHHL9un{L LyYTL(P1ɺ 1LoM@ 1LZH5SCFfDHZHjH9H,$fDLHL-Z1ɺM 1L濄 HsI~h1LHnD$L!HHtuH@(HLH@0@8H@@H@H@PXHH;$MIEHt L9PL !HIEHL9LHLY1g H5oo Mt9IEHt0L9t+LHLY1ɺP 1L濄 UDL ~IEHL9LHL.Y1v H5n vL M~FL A~11M LXL濄d HsI~h1LD$LLFLD$01 LD$0HHtH@(1LH@0@8H@@H@H@P輁dL }+HXXHxHk e|ExMIEHtBL9t=LH1L濄1LX_ HL!tH XL 1}IEHtZL9tULHLX1ɺb 1L濄@ L |1L1L$X_  1H@!uL |L | L1LX LVf H5O +1ɺ'LL8L \LX Lm 1LLLes L-K? H}H[HGH9u#fH}H[HGH9C uHCH@(HtHHЅuM1ɺ L1 뱿1LfK1ɺ( L H}H_HGH9vL-;KH}HHGH9YC uHCH@(HtHHЅuM1ɺ/ L1J DHD)kLJ1ɺ*1L L1LLSZE1H9m11LkJ1ɺ 1L@E9\1E1H9LU1S H5MhHHLELlS13H}A[L[ LI1ɺ-1LH k$H5BMH=SM N LzI1ɺ1L*HzHLL,$~ dE1@AWHAVAUATUSH8LH|$(HPT$HHt$ HT$HHT$L9gLHMIl$L9MDM?L9IwHuL$ttH|$ : AąEH|$5tǝt՗ uxs6H|$ H|$H#AąDH|$ AąAfM$$L9d$!MmL9l$tRHD$IUHHxAąuLFo1H5KuH8D[]A\A]A^A_HD$(HxPmtHD$(HxPk1E1L]TH5tL6G1ɺ1H5tyw/ LG1ɺ1H5tIGLF1ɺ1H5qt#!ff.AWAVAUATUSHHHH|$(HdH%(H$1HD$`HD$ HD$`HD$h聒HlHhL`I9ttLl$ fDLuH]M>I9u NfDIǾHT$`Ht!LpHcHT$hL(HPHHD$hIMI9uHmL9uLl$`L;l$ D$OL5fMmL;l$ WMeI|$0tA|$<uID$H@xHLH@XIL$1D$TD$HHHL$0HHD$H H1HHHHD$H9D$NHL|$XH$HD$Hl$|Ld$8Ll$@IT$IL$ ID$(LHHAHA$IuLHL$D$|ID$H$r tAmID$IT$ HxHHHHIL$ HHPIL$(HHPHHPPH9\$,HHD$L HHD$HD$|HCH$ tLd$XMtAD$0uqEl$4ELnAD$0t DID$LH@ HPAD$0uET$8EumIT$j<DID$LH@ HPAD$0uoHAt$E $1L2Q-H51A[A\H9\$,D$Nf|$NLd$8Ll$@ HD$(Ht$0HL$T1HxhQHH3DL$TEDH8AD$8A9H1ɺ'PL=QH5g1_AXH\$(HH{w |$OAH|$`Hl$ HH9tHGHCHHHH9uH$dH+%(HĘD[]A\A]A^A_ÐLM(ID$0I9tXH1ɺ*PH5LP1LY^9DL1P1ɺ%1H5zD$OLIO1ɺ 1H5J|$OAD$8HML$01ɺDLXPE1PH5 1XZ|$OtLN1ɺ?1H5ݨA|Ld$8LO1ɺ1H5Q]IٹL%NH5jD'LN1ɺ1H5\ H e$H51ɺ@L>1ɺ1H5bf$ۉADDVfDAWAVAUATUSHHHIHDIHLEhIHHtI9tH[]A\A]A^A_fDLL%^HL1DH)J|%H+U t[LL@I}8LP HCHHBHH[]A\A]A^A_H[]A\A]A^A_@H-*1ɺ1Ll=H1LV=1ɺPH1 AWAVAUATUSHL>Ht$L9III14ALL1LmALLHLFM?L;|$tLI<$LHHu1L<1ɺH5RH1[]A\A]A^A_fDH[]A\A]A^A_ff.AWIH1AVAUATUSHxMphdH%(HD$h1Ld$Ld$Ld$>H$HJ MnXIIHHH9uH~fH0HHHNH1H|$6 HL$L HHHD$HHT$H HHH9t;HLxAuIhHtHGH@PhH HHIGhH9uH\$IIADžIDžHL9Lt$ILfDHHCHBHIlIL{L3MeHCIhIHAIMI9MtAD$LHtHGH@PhHCMghH\$AAH9t HTLLt$H$HXHH$H9^LIHDHxHH1HH)HIIIIIIIFH@HzM!I$HL9HrLLЅH}L[D$`AoHT$@Hs )L$@AoW)T$PH}BLeIhI9tMtAD$Ht HGH@PhMghH}(Z HofH@ @HLxHLeL(IhHPHHHII9tMtAD$Ht HGH@PhMgh{xv C|qHH;$H}LchY IH.LH1H5 L `1 H5L*81ɺ 1H5ȟmHH;$lIHD$hdH+%(mHxL[]A\A]A^A_1H5gLLЅI$Ht L9L gLF1 H55tDHCXHH@fH5_IHChIG@HC`IG`HCpAAGHShH IIwpoAoAg^HS Hs H9H1HH9uHK0LC0I9t#H1f.H6I9ulH9t!HHH9uHFH IL9DHH I9uHPH@LH}H IHH IL61ɺ H5aIhHtHGH@PhIGhH}Lk @L%H-j1L HIhHtHGH@PhIGhLy51ɺ 1H58E1LU511 H:IG@HtHHt H9L /e1LD1ɺ H5NIG@HtHHt H94L dLD1ɺ 1H5g HChHHHH9LJL4\1} H57LR41ɺ 1H5/HChHHHH9HAE1H9tfHAH9uH PL^C1H5n7+XZn@1H5cLLЅfLJLJxL c@HcZ@p L ocLBH56fHChHtWHHtOH9tJHBE1H AH9uH PLB fLH9Hb1ɺ E1L2H5[H i$H5@6H=Q6L GAWAVAUATUSHHL$hH$H|$Ht$DD$lLL$PHL$XdH%(H$1AHtHL|$MtsH55Lu[1MpLYH5)H$dH+%(5*Ht$H|$HĘ[]A\A]A^A_2fH|$H*D$hH|$H2DۑHHD$(ED$h@D|$hHD$HHDŽ$a AHhh1L!ZD$SLL$Ht$8;XZEfƄ$0L$)$L)$ o#L|$`)$ok)$ LD`Dw H=DL HHt(H@HtuHt$H|$HtXD$xH H%SLYPL|$1Ht$8MQAYAZ1H|$HL HD$H$HH$DŽ$H$HEP`HD$0H!Ht$0FLvHNHL$PIVL91L$Ll$E1Hl$@Hl$(Ld$ MD$H#H@RML9B PH1wA[XLID$LL$ LL$Ht$0H|$IHM@(EO(D9I$IHL9xHrH|$@HVHHJH9AHRQLA1ɿVHP1RH LMM#Lt$@HDŽ$D$HHIH;\$HID$H@xHfLIHUHIT$(DŽ$Ht L9H]%PHt$H|$҃q:LL$LUH5=DHL$PE1H$dH+%(%HĘL[]A\A]A^A_H HL2VPL|$1Ht$8MlA[A\H|$HL#fDD$EIHt L9H\HML?1P1HIHHDŽ$AXAYH;\$Vf|$HtDH\$(LL$11L?)HL @11*H޿MX IIHD$ H9t"Ld$0HHSLL虿HH9uHD$0fH$Ht$phIG`)$)$Ƅ$I$8H$@I$HH$PI$XƄ$H$XIH$)$)$$h$xAoHD$H)$Ao$)$$(wIHIl$ID$IHD$@LmIH9DHLLd$ fDHUhI9tHHHH9Q@HI9uꋋIHHHH9}LHH 1QL~>1VH5-W۴H PδFHH~H{ HC !HEHC(HEHC(L0ILs(IEMLL9l$@IIH|$@HH7HH9HvHttL9toHRQL<1ɿVHAQA1RH LZD$HHDŽ$ HYY@H5IY@H9YH5)Yk@Lt$@ILL X{@LQ=1ɺ H5O,@MLv;1H1OHL%,H$H9\$ urfHCH?PH@@HtHHH9HRMR@L<U L1gAYAZHH9\$ =HCHo)UoX)]HCHp@pIHdH@hHGHH;H92HBHM@LP 1L_<YI?^HT$`LЧIEMuL9D@ uHI92@ tIEhHHHH9HBHM1LP2 1L-<@A[X IEhILHIEhHLHH@H97HBH@4 ML;P[HV@HyVK@HiV@IEhHHHH9HBH$ LMPL;1@NXZML91H5_)@HD$0L`I$L9d$ID$Ll$HH-()H@xHfLIILqHHP H H9u fHH9t]L9rhuMt}IHtuL9tpH@HRMPHt$8L:1 ^I$ID$HBH_AXHIH;\$t.HID$H@xHIE1IHTIHHtIu~IHt uiILd$ I9tXLl$(H:HEu3Hp@Ht*H֤Htxx @|j DHmI9u18I?1ҾHvLcMMMI$M9LMI@HIL9HIT$HzHG`H9|HH)I9sыt;VtSID$Ht$(LQ:1ɺ]H@LHH1@LL#1ɺ1H5OID$HML9YH@pHH\$81HSA[L9]1ɺH޿13ML9l$ e11Lt$`L%Jl$0Hl$\$LLl$(if.HH9HAAVI1PL&:1LHCHXZHH;\$ H{@L`PuƄ$HSHB@HtHYHH9HAAVIL91PL1D$(HAZA[H;\$ h\$l$0 ݉l$t L輂L脔L IML9ue@HL9UH{uHCHt$(L LHH1hHD$PH|$X1HD$8#tCH|$L3vtAp sps D5~pEfAG, Ht$H|$TBLE1@IHHIHT$@4HT$@tkHD$u]HBHILLW7HID1P1AVoAYAZD$0HP!@H Pj@HD$uHBHHk PIL71AVL1_AXDL)z HDHOJ@HyOLL$1L/vH5HLsG1@aLLL$Ht$(1L/-KHD$0@D$H|$0GHGH@PhHt$(1ɺ6L1HD$8#t6H|$.J5stm nuqI nubHt$H|$ D$hL1ɺHt$(1YwL^ HD$HD$IHH  uEHD$ Ht$(Ld11AD$l<VND$ltAO,MHt$(11LE7[HD$H|$L躢IG` HL$ Ht$(L11,x=kH|$HgH,Ht$(L#-11H|$H>hHMLhLxM94@MehI$Et$TI9H=LHtHxH?/u|AD$`AT$XAu  RIL7AV1ɺH5I1_AXL%1ɺn1LlLHIT$8L,AVAD$XAPA A% к PH5TI1]H t@HIT$8L ,AVAD$XAPA A% кPĀAD$XA  @1A…IcD$X;  HDT$DA|$TNDT$ I$AT$XET$TAL$`I99 H0 LHHL,11ARH57HAVRB:H MmM9IGHHt,HMPHt$8L]51Y^IG@Ht,HMPHt$81L^5XZHD$XL8E1Ht$(LA1ɺL|$Lt$LLhHH?A?#t8LDDJnEtWh huCD hEuHt$H|$u H _HL$(\D$hrL1ɺvHD$HHxfHD$HH|$1 H HL$(YHt$(1IٹLH@wHEIH@@H"HHH9 LJHL-HQ11LXZHEIH@@HHHH9LJHIغOQ1L|$LLD`DU H=fDLф HHH@HHt$(ML TH@'I@AG,V)IH|$@L7& HL$HH   Ht$(Lr11"JmALL$Ht$(1L>Ht$(L1ɺ_Ht$(L1ɺ'@8L EL E9Et$TEl$XI$H I9LHH1AVL'H5CAUR-H HIL,1AVHD$HƄ$Ht$ o0)$)t$0op)$IH9D$ t%HHHQ@HtuJ`HH9uH\$pH>HD`D迀 H=tDHމ; HHHHHHH9uDHH9HPB`uH=^=V IH IHD$0I9Lt$ L|$@HD$0LxIo HHDpD H=HtDH胁 HHHXH|H+H9pE1]f L#b @IEHL9Hp1Lb AHmH9hLmAEauEtH5ALHb uHt$(L;1ɺM Lt$ L|$@}L3 Ht$(11L V$H5 CSHmH9l$`@EtrH5+=La  ID$IT$0LHHHID$0AD$8MS1t$xHt$8IL$+| 1^_HD$0HHD$0H;D$ Lt$ L|$@L3 bMHt$(11L0*i%EtH5Z<L` ID$ID$HE1HHL$pIL$0HIID$0AD$8HD$`H97DEL1EuD;]LH@HHЃ8uH@H@Lh@MAEauEuJ L_ +IEHt#L9tHp1L ` E|H5AݺH5>L_ uHt$(L1ɺo Lt$ L|$@DL$HELD\$|KHt$(1L(Ia 1Dt$HD\$|D$jLA1ɺH5wLL$Ht$(1LI8ZbD$hPt#HD$u \$,D\$xErHD$ CIGDh̀LAD$`</Ht$(L1ɺP Lt$ L|$@_HI"AVLB H5<1Y^IGHHt.HMpPHt$8L)1uAYAZIG@HHMPHt$8L)1r:_AXdHt$(L\+E1LDT$H5AAD$XDT$I$HI9LJARL-;LL)3DT$ P1Y^|$3&8oI$HI9LJPH*f61PL 1L/XZHL%ZL 1ɺjLL <8L <HIPL  Ht$(Lb 1ɺI Lt$ L|$@"At$TAL$XDT$0t$ L$3L$t$ I$DT$0I9tDHt?LHDT$H1VLbH5.:Q1R;5H DT$L ;MHAL%|Ht$81]A\HM11AHt$8pL%A]XHD$@UHt$(L. 1ɺr Lt$ L|$@pHt$(L 1ɺX Lt$ L|$@DMHt$(1/L#?>ZHt$(I<L#1L :pIL9HNHHH9uL@HH9t@HPHzyMHt$(1DL$&WfH6L9u;L 1ɺH5zq$MPAL#MHt$(1L,2Ht$(L`$11SHt$(L? 11 WHt$(L$1fbHt$(L1ɺk Lt$ L|$@6H1MUL!Ht$8XZ/H\$(M1L#<HH޹1=L#>MHt$(16L0x H j$H5 H= Ht$(L1ɺz Lt$ L|$@-Hro=BhHD$(HL01@RHGat6HHH9LH1:tHBHP`u1Dƀt@HEfDATSHHHIIHtiH@@tHL[A\@H{AI|$E1HAHL#SI1H5A4XZH{AL3#IH541lAWAAVAUIHATIUHSLH(DL$dH9tMH%AL##IH531NE1H(D[]A\A]A^A_fHxCtDUUED 5ED$D$EutL3LL9uM6I9|HEPIVLHx(u܉D$L!#16H52DL$7fLq"1ɺ)1H52_A @MP1L轘YHLJBBL"D4EtPT$jE1jHuhHE1S^L"_JHL蝌bH LH2 L/ YtS Su5/SHLHD$H9HD$LLpM<$M9u}DIMM9tmIIt$LuI $ID$HAHH}P~tH}P聓Lu1ɺ=1H51E1eHD$HHD$H9RADL!UH0HD$H1cHLHD$H9tpHD$LLhM>M9u=fDIMM9t,IIvLuIFI6MHFH0IM9uHD$HHD$H9uD$tHO5H}PNtH}PQHt$L!1yE14L1.H5/[E1LD OH/HHD$1'HLH褖D$iLo Ht$1DL$D$Lt11?H5/跿DL$bH}PĸE1QW+D$sL= ff.ATUHLMt.HLJHLwHLId$`t HL]A\1ɺE1LH5G.ff.ATHE11UHHdH%(HD$1HGPHL$H8yt-E1|$AHD$dH+%(uBHD]A\HA-;L=IH5-1Vff.@AWAVLAUATE1UHSHHLHt$$HL$dH%(H$81HGPM9MDHHD$Ga<$aLHf:H1ɺeP\$1H5,LyA艽LY^HL$M9MDHEgLAIcHl$LIL4@I#DLu?IAxZHJ|0HG`tĀt@tLمtDHIAyDHl$t\LpH5+1裼E1H$8dH+%(aHHD[]A\A]A^A_@Hl$HD$ E1E1HD$L=3'HD$(HD$ HLI^IEPHx H=H|$ HXHT$(HL$AHPHT$(HHHD$(D9$$ELH1HELHH@H‹UPHXHc`HM81MIH5*1}MtA $HLSHH;\$INH1H!LLkW "H}PLLjHL躽HPHEPHH$Hx H$Ht?MI $HxHHIt HtHLH)H)H4LT#~L1ɺ/H5^'IIL`Id$`LtpL|LHI讐HH!E` $L\1ɺH5&1蟷D $L~ $LH5&1_D $A $҉ALL*L3LIALfLLl$Ht$Lk%s$L}1ɺLv3LmI~LU3L$I]$L%1ɺ$L1ɺ$L4H Z$H5H=ظIGa uWHHH9tAQLt2HHRHTfD8u L@A@a uHH9uH H9uE1LAWAVEAUATA1UHSHXL$LD$dH%(HD$HHGPL8jL1ɺH&H5$LI@(L1ɺIHH}PMpHHH9L$H9L\$HEM)A$IHAt$j AZA[IL~1H5#1~UpH}PL\$AUE1Ej1AVt$(RLjH0IH>Ea LLLM9I$8IO`I_`E1H9AD$ D9wAT$$D9M$$M9uHe0HLEAUI]1H5!舳XZH.0LIH5"1E1TDL$EL1ɺH5i"1E1HD$HdH+%(gHXD[]A\A]A^A_ù1E1LRH5"ɲI@ fDqAT$P9r,H AH9YLM9HHL$sHL$dAT$PDH@`I_`H\$0HD$H9HHl$1HD$ HD$HL$ HH9t@E 9w U$9wPHmH9uHl$H.HLzSIH51辱^_ H|$W;UPHE@ut$H9 HHoDuLAwHDEGE1E\$(Ll$AE;gDHHLpHxC&H@IHHЋUP:bHCHuL%1ɺ1L}LHl$ȰLd11L諰HS-L:I f.\$(HD$]PHHD$H;D$07Hl$HEPHM`HxHGH@H@HHt HЅKAZH|$4sqlHl$H,HLfjIH,LJIH51詯HE1I,LIH51rWLn1QH5}IHEPH e HH8HkHI9HH@LpHHD$LLhHEPLHx IH|LLHּLγLAD1HD$HMPHp` HD$@H^DD$Ht$@HtHEPH5$H8Y!HD$ HH|$IG`E1HHD$H|$(H9H\$0EHl$HD$HHD$(H9tfU D9w M$4 D9w5HmH9uHl$H*HLgATIHA E1jjjjjQjjjH$H|$pHPHHAOE1Hl$8Ll$DAE;wDEHHHRHLpHxHH,ЋSPER^HEHuL%,1ɺLLHl$L~11LŬ:Hl$8HD$@HH HHHSHHUPHPpHD$AHHD$H;D$0IHl$HEPHM`HxHGH@H@HH HЅL1ɺH5: fDH(HL`jIe>Lu1ɺH5身/H](LqIH51膫L1ɺH5Hl$]L1ɺw1H5k7L1ɺ}H5BL1ɺ1H5!Hl$8L1ɺH5ĪL[1ɺH5蠪\ L-1ɺ1H5Hl$kfDAVAHBAUATIUHSHHdH%(H$1IL HKPD@L{ IHH@PH5H8HuLhIE1H* ZYtdH$dH+%(HĐL[]A\A]A^f.MLF1E1H5V@1ɺE1LH5w.ufL1ɺ1H5MFeDUHAWAVAUATSHHH(MdH%(HEȋEdHH9nHIIEEH5{8HKHHHM蝯HMLHtmH)HHPHHH)HH9tHH$H9uH)HtHL4H|$HHH|LFHfDLHIH}v7H@hDH9w|jMLE1AVALLcuZY1M1ALLLHEdH+%(RHeL[A\A]A^A_]HI|$A$$)M$HA$jE$A ^L _I1ɺXH5-1 DH@HxHH5H.HKHLL E1cH5胦fDLE1]H5SfDL1PH5r$芰f.AWI1AVAUAATA1UHLSDHD$/[L{1ɺ HH5HIHHjAVIPEDjD$h1PAGpt$hPSD$辿H0IHDT$`EuDjDLESDL$HHrZYI~ H[]A\A]A^A_ÐIGPLLHDBaD9DFHPDL$hL$pAXAYHHD$LHEjDLSDL$nr^_L\$LL$#L$tI{PL$L$L;14H5^I~ H1[]A\A]A^A_@L1ɺ 1H5mH1[]A\A]A^A_fDIML9LLIK`L$\H<$H芐L^1ɺ*H5裣`fD1LH5t1=DI{PtL$I{PjDL1ɺ1H5mf.HHH9ǵHJA BLGa ATUH@1SHHZ:L$t@HL9tL3fDLCM;ELM61H9HEHH9DKAvADKE;u(1E1LH5o>t=f.I}E1DL0IH52>1mtHD[]A\A]A^A_.H1LJ8tIHH fDIUHBPH(I}X}HhH IH8H@fɾH HfɾHIF HHHxHHHǀH1H)HIEHP@ooXo` oh0HHV@HPH^HVHHPPM~I]XHNXHNpHVPHNxHNpf n0AIwHHHLH% IEHPPHH} IHI^IFHL0LHL%/<LA HIL1 ?rHHCIHBHHH L`AƅL1ɺ 1H5;qrIE`HtHHp8-T1L;AƅAIt3HHEH9ǸHD1AƅsIL<_Aƅ?I}XHtL _Aƅ6I}HHILeH9u$fHI $ILI9IHuHVBtH9~XuHt?LvHGPIL@HHGPHHx#AƅHuI}v^AƅHEI}H@XffDIEIHAH!P`(IHp`4IDžI}IUHHB HtHHtLI DLJ(H1SL<E1H5v9oXZDL HH4fI}LpI@I}`xHHH9t1H H9uHHHH9q1HH9uW@I]`H=HHs;YQLHH!Lg1ɺL%o81LnI}NLLI1{nLHP L 1ɺ1LSnL1ɺ41LE13nfDHHH*H9ukD8LpLLgPAƅIEHtH@PLHHx Aƅ)MuHMHIH9pHIFPLbHxIHuu Hf1LpIaL1'H5s?mLۮ1ɺRH561E1mL%6L1ɺLlL1ɺD1H56l\Le1ɺ71H5k6l6L%R61ɺ1L,L|lI}#LLI1Pl1LL13lI}L[LI1lL1ɺ@1H55ko@IFLl1ɺL%t51LkI}SLLI1kLHU L 1ɺL1ɺY1H55?kIv`$AIDžIEXIE`L1ɺe1H54j{L1ɺ=1H54jUH HHfLH0HXHL%641ɺ1LL`jI}LLI14jIEXHǀL1'H50iL1ɺ,L1ɺU1H53iVL%u3LX1ɺLiL81ɺi1H5>3{i L1'H5RiL1ɺbL۪1ɺo ATUSLGIIH9HE1HPHzGfuMu=IHH9uMHI#@`tID$H@Ht_L[]A\fKI|$H>H{I2UATILK1E1H52UhXLZ[]A\LI|$HL]IHPSLE1LIH511g6AWAVAUATUSHHGPL0HG`IH%H-D$ @hHHE1E1H9uf.HH9thD[LEtH:uHBIL$H@HP@cH5g L$IMtMHMH9uMGDl$ I w M90HAE MA$I~j AI~LMA$HE$N AYLAZIHI~LAEHMA$j H$LAUIUH5/1eH H[]A\A]A^A_D$ ;H5 L$IIIH9x@TL9sHAELMA$I~j; _LAXHIIH9xHAEMA$pTI~j H5.IXZUAU1L dIY^H95xD`TLXL4IH5F.1dH[]A\A]A^A_DLIL1LIIIHuH1HIILIH5-1d1ff.fAWIMAVAH1DAUJDATHUSLHMHLl$@HI9IMH$HHDjLJ LIXZ HH}H3jI$DL Y^ATAWI7=tL]H5,11bL_AYLDHAAE\HD[]A\A]A^A_f.HD11HHII9sMqAMH$LHDjL1 H}$$DILH3 =zL<$I1ɺK1L+H5+aXZDL#MDE}EtH$HHDjLs H}$$DILH3; =LI1ɺ=H5*1L<$)aAZA[@H$LHDjL H3$$DILH} ^_LHWATLSIDH5B*1}`AXE1AYL 1ɺSH5*Q`E1}fAVAUATUHLhdH%(H$1ID$`H(TH(HIHLJhID$`LaIt$H1L﹀jH_LhH1LH~LL7AU=AVL5))IL1ɺ1LR_H}XLZ1LAą111HVA=fDD$LLIH5(1E1^H$dH+%(HĘD]A\A]A^LX}LIfLH5{WHYHLYE1互H5(K^efDLܟ1ɺ1L#^=hfAV>AUATUSHHdH%(H$x1H$HHHHH;$<HDH5|H$XDŽ$HDŽ$DŽ$DŽ$Ƅ$DŽ$H$hHDŽ$pDŽ$DŽ$H$XH$`2H$0HL1ɺ1L-&LL\HHvIHH+H41XLLH;L1LE1WHtD$E1rEHEMp1UL1ɿH5l!AWXZHHw@H1Ht)HVHH9tJ HH9uHU1SHHo`Ht+HHpHtH5hZtH[]fEatHs@H.Ht @|H[]HS@HtBX1Z[۾HLK(LPsff.@AVHAUATUSHH9kUHuHGPH8-‰HuhHA9HEPHDHDL$HxjF IHEPHDL$Hx$ HIXZǽAU=vAVI1H5BL1@DY^[]A\A]A^HHH9HDGdDALESI1H 9YLv)H@Hǃ8u&H@Ht@gu׃9YLw׸[DLHAٺPLd1H5` @X1Z[fDf.AUHATUSHLHI9ĸLDGdt^AT$LtUI1DH@I$HH|ܾtI$HD@auIEA9l$Lw1I}H[]A\A]fHHH9RAVAUATIUHSH8tsHH1ZAąuCH諻Lo&IH5*1>[D]A\A]A^A[]DA\A]A^fDIHH9u@HI9tLkEcuLHtM fDAUATUHSHL.L9#H'fDIuH}KAąMmI9tGI}^AąuLؼ1>H57=HD[]A\A]DL+L9u)I}77AąMmI9I}LeLHAąu1L1ɺIH5_=HD[]A\A]Ð1L~1ɺDH5/=HD[]A\A]ÐH}w t ItNYAC1Lz~1ɺKH5ML9aEt AɅ:H([]A\A]A^A_L3D1H5z61H([]A\A]A^A_H}3HUHHB HaHHUHIH1SH5zL26Y1^둋UL1tƒA9ELwD9ADE1E1E1tmfLDD΃A4A9t/H4RItFcuA9uىA4A9uD9tAAAE9vMt I~ H([]A\A]A^A_@}LwIEPH8D$HEH@ZAEp1uLD$DMt I~誒 Lq1ɺm1H5]t 0H(1[]A\A]A^A_LX5H5t/H(1[]A\A]A^A_DMt I~* LFq1ɺv{AUtAV11jI}PRLSPD$DPDD$HEIH01ɺ^ILpH.D$fH@|$xpH $H5]tH=nt1ff.AWAVAUEATAMuUSLMHL1H1HHH!H LIIĉ1IH1HHH!H LIAt!EtE1D9tED)A)A9DBHD[]A\A]A^A_DI1LLH1HHH!H LIIQ^f.tRHwtFu> tɾDΉHҹDщ1HDHH9кGHG uaE1F uP@t AFu=t AF@u*HHv(H(0E1AHDD@E1F t t@tAWAVLAUATUSHXLHT$HL$dH%(HD$HHGhHD$M9|@Ao8LNn1ɺHGPID$(Aą9Ht$@LsAą[9C1t$(EAG(Aхx9vH|$@gHD$@A)VAGH}*H\$Ht 1H|$@IEPIAG(AGHI9v?KL1tpfHH@HHxHHH1H9tD1ɅuK(P P$H(HH9uH;kLrA0LLDIH5go1+HD$HdH+%(HXD[]A\A]A^A_Ll1ɺIDH5o1E1*IAWLH|$ GHG)EDAG8LT$(DL$0D$,PEGLT$(D$8ADL$0IGH@IEPH5zDL$0DD$(H80DD$(DL$0HIGAG81LDL$1{)II9(=xLL)+D$8L軛AąII9H5>HHtWL"HHD$t@HHݵLD$tDLLɵt5HD$L HD$H(VLt\1ɺn /DL\\1ɺr ff.fLHI9.EALEtiK @I1E1HHTHt6HR`u*u"IHtHTHt HR`tAHH9uDtff.AWAVAUATUSHLDL$ dH%(HD$x1HH$I9-ID$HAIMALXAtET$LEdD9%7A$D$D$ID$H@t AL$LL$LS EbuUHRY L-A]LL,LS| DL-]1LLVZ1ɺ 1LE1HD$xdH+%(]HĈD[]A\A]A^A_ÐH}PgK?IT$HD$`L|$PHD$ HD$hHD$`HBL|$XL|$Pt A|$Ls HD$8 ALD$ D+l$LD$DLHK3 ID$@t A|$L LL-\xHEPH8ID$@A|$LIl$0"H HHE$6H LHm` L9$$b+I$E$HH5gH@H P`HEPH8ID$HL-F[LX1ɺ L"@H0RD9HDT$L-Z[LLLI 1H0LQLI 1]DT$D96LL9$$L*fM>H}PIAąMMLHR AąHH9$*XLJDd$ EdL1HAąDH}PL8Aą] HAąLW1ɺ 1H5YTLV1ɺj 1H5{Y'fL-cYLV1ɺ^ L?fL,@HEPIHLHxw H:1LH I$HAD$LHH@H"LI$HEPHHxrw HI 1LHI$HHtAD$LHH@HW"HD$Lt$PA\$L1I$L-oXEM9Ld$0L|$(MMLl$8H訐II蜐H LATI 1LIWLB`HHM!LB`AYAZH9'L!h0H|$01ɉM?L;|$(nLd$0L|$(H\$`L-WH;\$  Ld$(Ld$8Dt$L|$IfDH؏IH̏H L(SI L1IWLB`HHM!LB`^_H9&L!`0H|$(1DM?AL;|$ oL|$H\$PL9tH{gHL9uH\$`Ld$ H;\$ tfDH{?HL9uHH9$' L$D$ HAąHH9$:&BLL@L1E1L\$ IDILItHy`HV`H tHAHV`Ha`HL9uEt?H}Pt H}P!u%H%4 LI@ADAL-UHH1SIL% L1_AXlfDHMML|$(蝍I~H葍HL~SI L1ZYH\$PL9uHL9H{ u1ɺ LLRlHLn IH5T11@AAt$L1ɅtH\$Ll$A@DH@I$HH؋tHx蛧cAE;l$LrHp_ LoIH5S1E1L) L-S1Li@LP1ɺ 1H5S?HO L}ImE1LP1ɺ" 1H5CSPf.Ll$`Ll$hLl$`@H\$`Hl$ H;\$ ufHH9H{u1ɺ LL$P|I$HD\$Ll$oH)D$`HpHt$po HrHpfoT$`HD$pHBA9L$LKHB HCHH7LHHL-/R萊HLSI L1 A[[L-QLEO1ɺ L fH؎ EuaHHIH9<$!HWHB HHHHH1LHH=2HI1S1LH5AWXZzL1HLLAąL>1ɺ1H5dA5fDyL"IH52A1E1HD[]A\A]A^A_L\>1ɺ 1H5@E1f.H8yLIfHyLI`LxL,-IH5o@1;@LE1xHHxHH54@SIL&1Y^kxL3IH5?1L$=1ɺ<1H5?gfAUAATUHSHHH?h53tA st) t.HtH;u5AHD[]A\A]Ðg Uuf.HHuAąt^H[HEtHJtvHNtjH}ht Ӌtyf6\L <1ɺy1H5>O;f.L;1ɺ1H5s>E1ffAWIAVAUATLUHSHLt$ dH%(HD$x1M9LDHIAULALHٳ Aą^IDžAIGPHHHH9u aH@H9tWLH#PtIED$ AHD$xdH+%(HĈD[]A\A]A^A_AL1/H5$gIE1L^:H5<1E1sHLsAąt9HD$xdH+%(IPHĈH[]A\A]A^A_L91ɺ1H5{<'fHD$PHHD$HD$XHD$Pt L@JIH53<1MM9M AFLLd$`Ld$hH@Ld$`HIGPHHT$HxZ HD$ HH$HT$1AFLH4@IGPHHxSZ HANLtNIH IH4HH H|$`HHL HL$hHHHHHD$hHH9uHD$`L91@HL9uIGPL4RIHxLY HD$(HL1HHD$`L95D$Ld$8Hl$HHl$Ll$@II}$sVH5:IL1 MIGP1Ht$(I}HH9ËD$HEH@L$ID$HHD$07D$H|$P`HD$XI,$ID$HD$XL Ld$XLd$PI9uPM$$I9CI|$HfuLN71ɺnH59L;rL77IH591dL rLMIH5915L61ɺlfL61ɺ1H5S9L61ɺS1H5-9ALt$PI9uDM6I9I~HXuL@61ɺaH58MmL;l$8Ll$@Hl$HHt%HH9tHHPHH!H9uLp H5n8IL1SH|$HD$ LIp L]IH581Ht$L菜 A4LIpL`IH571r8LpLiVIH571>L41ɺP1H5l7I}Ht$0HrI}oLz~dIH5"714L\41ɺ/1H566 H $H57H=7&AWAVAUATUSHXHT$Ht$,dH%(HD$HHHT$HD$ H9L|$ HIG@5DMpHD$0AWLE1HD$1MHD$8HD$0EIBAH@HNLl fDH9HLL9t fP 9wD@$D9HL9u-nHL%5SILLU1NY^L21ɺ1L/HmLE1IL~:1HD$HdH+%(HXD[]A\A]A^A_HL$11HAąlL1L9|$LDE9EGHI9ElDE1AE;nLspIDH@H|9_pvމ诱uL%4L11ɺL)L11ɺ1L AL1L9l$H5^LDHEPH8bHH5HAELE1E1jHjjAUTARDjAWPjAE8PHPHH|$0HT$HHT$8HPHT$8HAVLHD$8ADD;ephH|$0MH;|$+1E1IE1+MDH@IL@IIH9t @C A9r C$A9HH9uLkH LdSATIL%31LXZnDL%21ɺ1L$0LtFL%2L01ɺLM1HDLH AWLAA9M6Dc$L;t$HL$ALH@ IIGHt$H|$HBH諞 HEPHu` H5}\H8`HT$ HBH|$,A1HAą L/1ɺF1H51XRL.1ɺ61H512,H% L%f11ɺ1L.LHHL%11iLyLI1H #$H51H= 2KL4.1ɺB1H50E1tnHD$HdH+%(uTH}PHt$HX[]A\A]A^A_L%0L-1ɺLL%Z0vfDAWAVAUATUSHHhH<$t$$T$8HL$(dH%(HD$XHH9'H1JPHAH9up81҉t$ pLt$ HLt9uHH9tmHHAuH<$hiLyIH5/1E1>fDHD$XdH+%(zHhL[]A\A]A^A_fD$ dt$ FUH$H@PHHHH9u{HmH9kEtHD$@T$ H<$E111IHD$HD$HHD$@H$H5BYH@PH8s]HHHD$@HD$H;D$Hl$0E1IDd$OL"11HELL\"1ɺ1LafD L1LoxH+AąH$LE1HHD$HE\L p LI1L|$I9u bfM?I9tXIߘIWD1IHAAąuLu!1ɺ1LzAhDL1L2o>fDAWAAVAUATIUHSH(dH%(HD$1Ht HELxHHH$IHD$AH9øHDMHCLDHEPLHHxA IHHuMA1H JH8L(8 HACLL,$E1uuDL4@HIJ|04ytgHt5Ht$DHFHHHJ|0xAD9cLLDHHHyL1ɺ1H5,"1HT$dH+%(}H([]A\A]A^A_1H YH7L7 xLILQM1 I$1ItH|4lH}E`>II$H|K>HLYAUIL1rYDU^hLmL1 LvY E1AcfDL,LDJIH51蹯H$dH+%(HD[]A\A]A^A_DH](H5HM|$HĹL wH xI9 I|$LL$(HL$+HL$LL$(IID$HP Ht HHh LHL$LL$(H1IH=QLLM\$IC.u  QAD$LAEZD)A9EI|$D\$H<D\$HHID$HP HTHHHLD\$HIAS1L9uLD\$PS3[AXD\$H L{<IT$t$8LA2H$Iu`D$l9D$\$L)XH<$DL$lLe8HWD+JS{ P!A@t H#AH5SHHIL#GHHuHH#~@uhHuLLL7o ILP(I|$LHL3ASISZHLLME1HL Mu^L=11ɺLLLL$(aLL$(11ɺT LL:LN LIL61 L6F IVL=)L{1ɺ LĖjIH9\$oH9kHu(LuLLu(I8LIHCHp(uHHCHH HH HHT$HHT$I='ATL8AV11AWL=lRLJH |$8"HCH9 Hx(ltHu(H`1҅‹CL|$ ;{8|$ {8HkIm`L11 L!ZRIH9T$HJr(BLQHAu9)L5%HL= LDEALXM LARL7P1肔A[A^1HL$0DLlg1ɺLLIL1ɺ 1L,L=j1ɺ1LLAL5A|$8t LIHCHP HtgHHt_HH1LH=t6jL wLILB11HL$01LaX1ɺgLL׎Lz IID$HP HtHHtwLH‹t$1+t$LH=E0eHLrÅ1L1H1C ÅL9H57H{e L1ɺk1H51„DLT1ɺx1L蛄^fDH8HLpSIsH511ZAZA[L1ɺ1L3fDL1ɺ1H5UfL1ɺr1LfDLt1ɺ1H5跃fL1H5范L#1ɺ1Lj-HHD$IF$AHH#E`H HE`蕍DUSHHdH%(HD$1D$u%HC?HHT$dH+%(uIH[]fDH5HHtH@ H@XHt1HT$HЅtD$t1ff.@AT1IUSHGhHHHDH1HH0HH\HGPHH81H ID$P[H]A\HHHH HH)H)HHEHH9HF1HA RIH9rÐUSH,RHHHHDL$Hxjn 1H5;IHD)L$Lo'HgA1PH1[]HE1Ht HGdtDËuHPXHtATUSD`THBh1H_hLLHHI1HH8HHlHAPHH8E1HIH9[]AA\DÐHHHtDEtHG`u>HHtHtHfDuHzXHtGcuB3t1H1L1ɺH51Hf.H1HtGdtuHB0Hf.USHHHo`H0rt,HHH9HHxGdHtH$ss@L K uwHHS`tHL m%uJHHH0L #@uL 1 DL 1L%H5s~1H[]@L df.L HHtH$r L 뀐HH}H1L uZH-1ɺ1L$H~L$11H}1L$1ɺH}HHH L AUATUHSHHH?H[XHHS`AŅt HHpxHHNH1tHH9u HHxvAą;HDžHh5H{PEcY^HCPHH8AąH{P>NHEPHH8AąHCPHH8AąLKH}1LH5:|DHCPH8t$  V ua HCPHL J[HLoR AąlHS`E1|RHL8#H5]H@LHH1{HD[]A\A]]toH{PMHA[D]A\A]f.=fDLl1ɺIH5Ͻ1{fL1ɺe1H5E1zHD[]A\A]fDO,HAf Lj"_IH5W1zf.L1ɺo{DLKH>1L!H5@zHyhtHy2HHS`HHa0HAhHǃHHS`LKHi1L!H5yH{PN%fLMHx1LDH5NyATSHHuKHHHt#HHfAąCauYAHD[A\HE1L(!cIH5SE1xHD[A\fHL)!1ɺqIH5E1xHc`nL<1ɺl1H5DxGf.ATASHHHHt8t>H.fAątgHAHǃHD[A\D1E1Lr H5EDwHD[A\fDLl1ɺ1H5Dwff.fHG@tZHHHuH9u0H9ptHH9t"Hvu9Puf.1DHHLIH5jC1w1HDH9ff.AWAVAUATUSHHHG@5HAAHEAąt`H{HS>HE1H0HH5BSIL51TvY^HD[]A\A]A^A_HC H@PHx HAAHhDhHEH8HAHL ݕ LFAHPHH5 BHWHHLD1u;DHE1,LP.IH5A1UuDx4HEE1P81LzH5pA uXZDH;HfDL\>H5Atg$& @UHSH8dH%(HD$(1Gd HGP@aAE|HHH9u eHH9t]HCHxtHCHxLIH5i@1t@ H8uK1HT$(dH+%(upH8[]f{LoIH5 @1s1HHE1E1jHjjpH t$1}@ATUSGd HHH9ŸHDOtE1AD[]A\tHUHtHR HJXHtHGPHO1H8AątGqOsE1LI1H5>rD[]A\ÐHUHB Ht9HHt1HILLW1H5>Or+LJ(@AWAVAhxAUATUSHH8HWdH%(HD$(1HHJPH@hL)HD$ HtTHmfH*<-A^YR,t Ahx=t@x}A9OA)HRXH=LPH{HT$ AąPHT$ HBp8D@0 ȉ ȃD Ai@B9O;jBD99HBLH(L9tfHH9HEI9tIL%H{`HH1ATI1L?AUH5<E1UpHT$@H H: HD$(dH+%(H8D[]A\A]A^A_fHELLDH @HDH@HDL=LD$LD@H{HL$L%HT$LDHLD$ IH5<1APHL$ LQHT$ 1RAWATE1oHT$PH0HB@8cHƃfHH H*X~f.HQXLFLIHD$ p3H{HAT1ɺ=UILK1H5T;E1nHT$0XYDLLIHD$ pH{IfAV31ATI1H5:LkE1nHT$0^_B@L~LIHD$ pkH{IAWL1ATI(H5:1E1$nHT$0AXAYfDL1ɺ1H5S:m{f.L%?xff.@AWIAVAUATUSH8HGPL0HG`H$H%:H$E111ҾLLD$L1LD$(AdE1mLLD$E1ۉD$,IpPHHH9fDH{Gd HWXHGPHLLD$ D\$HT$LHT$LD$KLD$ H{L$D\$IpPA9DLA9DOH9<$t9HHALhH9tf.HHHHIHihH9uHHH99I9H5HAcEI шL$L9jHHD$ML=LELL$HAHEI~H-#8MA$j 1HIXZt$S1LAWLT$AR}kH |$CH8[]A\A]A^A_f.H<$H4$1HHL~hH9tHPHHRHjhH9uI9fHPXHD$,L$(-fDHHH9ԀHH$H3dHIH9HHDHD$HyHD\$HI~LAEMA$j HD$Y^D\$&=HL11jAc~0=_HL11iE`=/HL811i4H<$IL@I|$MH-VAVAUATUHSHFhHDoTL9r!1IHuA[]DA\A]A^DH{@AąuHEPHLHDL$Hxj HuhIHEPHDL$Hx$ H{IXZBHH7HLAUI1AVH54SWhH D[]A\A]A^ATIUHHNS5?HthH5 HHjt2H5HjugEA$[]A\fDE[A$]A\1L"H53g11IٹL"H53ig1D1HvqStqHLW$LjDL׃ L"1H5Z3IX1Zf[fDL1ɺH53f[fAVAAUEATUՉSHHDGTHHpt[EuFu HCHH`D$0ADHǃ[D]A\A]A^ÐHCHh`3@AL11ɺ"H5`2e[D]A\A]A^UHSHH5HHhuEH[]f.H5HqhuEH[]f.H5HAhuEH[]f.1IٹLJH51)e1afAUVATUSHHw@H[]A\A]H$ HDjL H{$DI$LP H{$DI$L Y^AUATILi1GH5k0 d_1AX@ HH{$DjL H{$DI$Lp OL$$LI1H5/ecXZ1H[]A\A]fDAWEAVAAUIATUSHHhH$HL$@DD$(L$HD$H$HD$0H$HD$H$HD$8H$HD$H$HD$ dH%(HD$XA$D$(HD$HD$ LKH0҃HD$HHD$HNE$EDEJ41HHD$8L=|.IHHHD$PH9JD(1IIHD$PLT$(HHDt$LL$@HLD$`AXZELT$(Lt$IHT$PHA6H =H1H{AHI$H;D$8HDLHj/ A4$$$H{HDL =wLI11LH,$`A4$]HA^QHD$8A4$IH9[HD$DE*HD$ BHD$HH{$0DjLI6 1LILbX1Z4`AHD$XdH+%(QHhD[]A\A]A^A_ED1IHD$8IHL$PHHD$(t4 ) E$9Gº9BEL=+A9HH{j$L=+DL" YL^I1ɺL1 _E$ PXLIH5G+1^E1fHPC4HLPH=A$HD$LMH3HMLHt5HH`H|$^D$Lޟ1ɺTH5*1!^DL$LLH3HhHLL+H|$ ADL$Lg1ɺL1]DL$v@A$%H5HD$L1ɺDA4$HH{$DjL YL^I1L1\H$jH{DL _1AXILxL1\Lt$ 1L 1LLAX\AHDLHj A4$$$DHLH{ H,$L IL1[AZE1A[A$HH{jL='$DLb _1AXILL1_[E$_fDHL$8LLHUDEA4$1HD$8IH<HH1HD$PH=v>Ht$H!@HA $H=HƁvH΄tHD$PHH{$DjLt A_L=&1ILXn1LjZHD$PE$R@H4H1HD$(t!w% ) H{L=L&$DL9Gƾ9BHj AZL A[I11xLYHD$PE$fD$L1ɺfH$DLjH{ L^ H$HD$PLH()@HD$P7@LPfD$Lx1ɺc4c@HHH9nATUSHH9HHHE`t H$H H@L%%uSHHH9HHDAąA[]DA\L%HHMPtL 1H5$E1WZYD[]A\L%OL%hfHZ}1E1L H5#9WL̘1ɺz1H5s#WZf.AWAVAULATUSH8dH%(HD$(HL9lHH9Hu\AHH}PH8oH}P(^HD$(dH+%(VH8D[]A\A]A^A_D%%D5ַEu ǷH諻K1HI9:lHHH9txHH9uHEPHH8AąHEPHH8;HEPH85t uR RuD5HEPH8Qt_ uEHL9\kHwDL1ɺ1H5[!E1TyAgDHEPHH8AąH6AąuD5.D CHH-HEHD&HSIL5H5 1JTAZA[HEPDH8EtmHHE1E1jHjjH tE<$t>H1I9HDHZLIHhULIL%1LSL1ɺL 1E1nSfHEPHL82HL) HE1LIH5r1 SYrfD-uD5sL{1ɺ~1H5"RCfLL1ɺ1H5Rf.HE1%LIH51NRfHLIH5w1R:w\wH AJcH>H}(HHcHZH]yHBHAHA11L;H5PQH;H@AWIAVAUATIHUHSLH(HL$dH%(H$1I@ A@(HUHLHHEPH襵 HLt$LLIL H$xHCt4H$dH+%(H([]A\A]A^A_fDH{HCHGH$HJ HrHtZ1HtSH9UHlfH*HfH*^Y,ЅDHKHƉS H)HtZ1HtSH9H;fH*HifH*^Y,ЅhDЉS$HHH9eHEPdHHH9Ht@ H~fH*^Y,ЅDЉS(;HxLIH51N1f.H8HLpAVI1H5[NX1ZfHH_1HTH9FHVfH*fDHD$HKHLpIHC@HD$HKHLpXHfHH H*XfHƒfHH H*XmfHfHH H*XfHʃfHH H*X1fHƒfHH H*XffDfDfDlfDHfH*XWff.AWAVIAUATUHH5SHH(L$L$dH%(HD$HGPHD$L8DLIH0 ILHH(1H DD$E=2*L$1ɺ1L[L޿KIFPLLLD$+H|$H=" UH$LT$HI)LT$M9 LIFPL\$HLLT$HDL$Hxj Ht$HIFPHDL$Hx$ѱ Ht$L@I1H$JXE1ZHD$dH+%(H(D[]A\A]A^A_DI̋$H4HHt$ hL1ɺH5WJE1fLLz1LIL޺1!J3IIFhHD$;fHH)1IIVPH:LȉID$HjH萰 =AZA[LҥI1L1L{I L@1LH ]LIL1҉"&HiIIH9|_oE<$LjA$oM4oU DHM0HTM8`\ dIN`@Hh`? @HT$HLx{L$ULLI^LL1L$LT$_HLT$L$L$LIH5c1HD$RDL1ɺ}1H52GE1$L|1ɺH5GE1$R@AW>AVAUATUHSHHHHWPdH%(H$81L$@LL:HFXƄ$HDŽ$P$tHF@HH$CHL$L$DŽ$uEp$$H$H$%H$HH5NH$ 1H<$HLH$H$(HDŽ$0DŽ$@DŽ$HH$H$胹H$IHo=Lc@HMHMXH$HL]eK\LCPH$$HHsH}PL_IHcH[@HH$8dH+%(&HHL[]A\A]A^A_f.H@ H@XH>1H$LЅ'H$LO*LH(fD5uFjCd11HPDKhDC`?ZYK\DHEH1LW1H52DK\H<$H$b LHb H4$La uHEH1HLH$XXH$XLHH$H8HHL9HDB2JHLII9HDE111J9<1ɺ-E1LH5>DLL$1LHLL$X LL$kH}PLιLLL$LL$HLHLQAL%1ɺH5jCD1ɺE1LH5|>CSfL̄1ɺ 1H5RE1 C!L1ɺ1H5"Bf.HxL(IH51E1BfL,1ɺ1H5oBf.HLIH5v11BF@Hо LIS1ɺ*E1LH5AfLH5AL@UHSHH5(HHQDtH5H>DuBELi11ɺBH5z7AH[]H53HCt%H5ٟHCu"E@f1Iٹ=LH5@1DAVIHAUATIUHSHRLSHC4LTHC5LUHC6iLVH !LWHCALYHC.LZHC7!L[HC L\HCL]HCL^HCL_HC L`HC$LaHC(LbHC,LdHC0mcHLCJH{8HtbLeHA H{6Iu[D]A\A]A^@1L71ɺ{H5>[D]A\A]A^ALa11ɺvH5>[D]A\A]A^AWAVAUATUSHH $HH|$ HH$Ht$dH%(H$1Hi HD$pHD$xHDŽ$HHDŽ$HDŽ$HHD$@HHFHDŽ$H$HHDŽ$HHifHH HD$0I‹FHHiHH HH$HD$XHD$hH9HCƅHDƾHHD$PAHh"H&HLHHHD$HHzH$HD$xH$HhH$H$H$HVH$H$H$H?H$H$H$H)H$H$H$HH$ H$H$(1 oH5.HPIHD$HRHL$0HD$(H$L$H$f.HT$L@H:LEHHHHD$L) w1HLL GHt HuƄLd$8E1MfL9v4J\5LHIIL<$M/L Fx&LsL9wMLd$8:f.HH|$FH$HT$xHH HHH$HHHHHHH9HGH$H HIH HD$@HT$E1HAH|$0AzAzADHH|$0HD$@HD$@oHD$ Ht$HIHxDLI ш$$L9jHHj LHHD$0HxLшT$$$D٠ Ht$81H$I.1L9XZEAH$dH+%(sHD[]A\A]A^A_fD;CLt$LH$H[ MLMLd$8HD$8DEL;$HL$8Ht Ht$(M1ɺL19LL$XHt$(113LA8HHj貟 LHHD$0HxLшT$$$Do Ht$8LI&1H$f8Y^ELL$XHt$(L=*11E1*8cDHT$ HH @|$H$HHjLD跞 H$H|$xHHS1p_AX"L|$ HƃH HcAA$M@|$IjEE Ht$`IAMIH шT$A$$E H$MH|$xHHUH>L 1oAYAZKf.L|$ H|$HAHwIMT$A$jEv Ht$@IAMIH шT$A$$E0 HcH|$xMHHH$L H@1nA[A^iL|$ HA]AIMT$A$jHD$(EH0覜 Ht$PIAMIH шT$A$$E` HcH|$xMHHH$L HH1!nA_XfHM1PHt$81L5XZf1H$0HH$0BtHHIHD$($L;1ɿPH$HPH$pHPH$HPL$xHHIHD$H1j4$H$H$xH HHHIH C>AVAUATUHSH HHI IHHxHHHǀH1H)HHt9H8LLpL蕖 HHLHAI$HH4HI$=Ml$L5H5,I$I$I$I$I$I$I$I$I$I$I$I$I$I$ I$(I$ I$0I$8I$0I$@I$HI$@I$PI$XI$PI$xI$I$xI$I$I$HAD$PHD1HATI72XZ[L]A\A]A^fL1 H50+1Lt f 1E1LH5*1L'1H5*IDŽ$E11L KAы'SIuk1H=H  HH=uH5ZLHfH3H9uHI9uAMAIH=HLEPApIA3XAPDEB3AAB3 DB3,EAEB3ADABAAED1B3$AÉ(D1303<@343833 @33I9AEt$DH=uHH13H9u[LfÐHDIE1LLIHuHH uGHAR_LV1H5e(1/XZ1HARIgVLAUATIH5 UHSHdH%(HD$1H$D$. HT$H5H AA t@tux$D$AA$HD$dH+%(HD[]A\A]DHEL uHtLL.17H5Y).HEL ]uHtL=1E1L'H5-ZL8ff.UHH02H]2fDUHH02H]2fDAUL-1ɺ.ATLL1UHSHDOLW-DMP11L/L6-HHt!LHHL1L11 -11L9LL%,1LH11Ll;L,}LvfLH9]LwHLL+1[>]A\1A]d,@HEHH@PHDL$Hxj 1LILX1Z6,ff.fAVAUATL%USOLH1L5L-A1M1ɺ!L+LHEL9wHHt]tY1L-Bf.HH@HDHt%HpH(1AM1L&+XZ9]Lw[L]1A\LA]*1A^*UfH1SHHHHdH%(HD$81H)D$H|$1)$)D$ V HtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL qHtLL1DH5z)*E14ff.@AVf1AUATL%ULH1SHHPdH%(HD$H1Ll$)D$ Ht$(LHD$)D$)D$0^ Ht%LHH AąHM0 L%$f11LL)D$ )D$H\$()D$0 HHT$H5yH Ld$<Mtf11LHғ)D$ )D$H\$()D$0螄 HHP HHsHW9AHD$HdH+%(HPD[]A\A]A^LHH Aą6HEL oHPHHCHtLHLMR`DHEL oHPHHCHtLHLRz1H5UE1(XZ6f.LuLI~PHH@HHHH`H@PH, fDHEL nHPHHCHtLHL*RVH51d'^_DHEL nHPHHCHtLHLRs fHDžHCIVHL NnHtLHL+RiN1ff.ATI1H5UHHWLL# E1 HHtHPHH51L#t1H5Le# LAT$ t!HHL]HlA\\Lg1ɺiH5Ά&H1]A\HEHLH@PH1U$LYg1ɺH5%@L4g1ɺH5y%H1]A\Lg1ɺH5I%C@Lf1ɺH5m!%ff.AWMAVAUATUHSHH(dH%(HD$1H?Lt$`Ll$hHT$LH1 AąHt$HFIHIEH~HMtAGP1HHAHtY1HtRH9YH fH*HfH*^Y, =D‰HA HD$dH+%(2H(D[]A\A]A^A_f.L|e1ɺ1H5#DIHH $LL$菆 H $LL$HHLL$H$L$LL$AM$HȃfHH H*XfHfHH H*XffDfDH$L1H5)"L$LL$Z5-DAWI1LAVAUL-ATIUHպSHHhLvLH|$dH%(HD$X1g"HT$(HHǨ LD$(Al$LA9hIx H5LL$,L$D$HD$0L4$E1HD$DDL4@I$IJt0H$H@PH8EuiLNHLL11!LD$(fDH|$Lc HD$XdH+%(Hh[]A\A]A^A_fDHE1E11jjjHL$(,SH hDT$0EZHLLD$HPDL$L1 HD$8AXAYL$AUATUSHHHAXHtVLhHL'H}L`Lz H~LLHA%HCHC HD[]A\A]@H|AHBHB HB@( t1LP1ɺ H5UHD[]A\A]ÐV1E1LH5XqAUATUHSHHL MtHL8L`H}Lz HtCLLH%HCHC H[]A\A]DAL-{f1L:VH5qH1[]A\A]ff.AUATUSHHHAHt H@HuUH{AHCHC HC@( t"L1ɺ 1H5,HD[]A\A]fDLh(HLH}L`Lx Ht4LLHA#HCHC HD[]A\A]f.V1E1L"H5^gAUATUSHHHAHt H@HuUHzAHCHC HC@( t"L1ɺ 1H5,HD[]A\A]fDLh(HLH}L`Lw Ht4LLHA"HCHC HD[]A\A]f.V1E1L"H5^gAUATUH1SHfoD%dH%(H$HHT$ 1D$XfoHD$(D$xfoHT$@HD$HHD$Hraid10HD$HHD$0Hraid0HD$8H HD$PH @HD$pH HD$hHDŽ$aH$HDŽ$$Ett>Ht ED%H$dH+%(XHD[]A\A]ÐHL$ LL$LD$H5DhAąT$ H\$L$L-Ct$L$9retK.I1LL1T$ H L9utA H $@C9wuC9rfDC @D$t uD$uL 31ɺ;1L#H5Z*DLS1ɺ(1H5/eDAWfAVAUATULSH(H|$H$L$`L$hdH%(H$1)D$p)$)D$P)D$`HI@@@7uL@HEHD$H@HD$(% HD$HHB1Hl$ HE1Ld$011E11AHII-DEu]Lt LHH ŃH9HH@`t MIM LuIALu?EAE!EtLq1wH5\rf.AI1HT$LLt D$LH}ƌLKIH5!1H$dH+%(5H(1[]A\A]A^A_DHD$8E111HD$ HD$H@ H HHT$0HЋT$0IHEHD$H@HD$(% HD$HD$L$@DŽ$ML)H|$$uSLt$pfo$fol$p$$E@$$ED)$$)$E8HE1D$$HD$ H$@AHA$THLuK HLL4F H$\$@ fo$fo$fo$PhH$X8H\$ fo$H$HXx$H$HH$dH+%(DELH|$LHH(1[]A\A]A^A_fDHD$Lx(fHELRH5zLHH1D WH|$|DŽ$EL$Gf F1Hl$8Hl$ Ld$0UHHD$ HA@L[1\H5 HD$( $EL$gDLN1ɺH5a`~LM1ɺ1H5o? RM1LH5~LHHL1cH5 $E<DŽ$$HD$8HD$Pfo|$P)$fo|$`)$~USHdH%(HD$x}t59HӅt69HtHT$xdH+%(HĈ[]HL$LL$8LD$ H5@z;8t|$uL$ t8fz|jHl$ PH`JLD$HL$H1HT$H5' A/8A|$|$|$jf.HGIHWHHp0HBPH8~uff.HGIHWHHp0HBPH8Nuff.HGHWE1Hp0HBPH8\ ff.HGHWE11Hp0HBPH8/ ff.@HGHWE1Hp0HBPH8 ff.HGHWE11Hp0HBPH8 ff.@AUIATUHSHHHt)HHH9ƸHD,AąH]L% xH9u5DHH9t(HsL,uHA[D]A\A]@LHLBAąu1LH5WHD[]A\A]f1LI1ɺH5pHD[]A\A]ÐAUL-ATIUHSHHH9u 3HH9t(HsLTuHA[D]A\A]@LLHjAąu1LJH5HD[]A\A]ÐATHUHHsIHtrHԋHID$ID$ HdvID$(]qID$0Ht IL$ML$(L<11H55HL]A\LuH1ɺ 1H5 fDAWAVAUATUSH(HL$HL5oHHHD2HD$CfHM1LL_ Ht$LHAąHH9\$toH LkHHL$+ LI HM|Lh HL$HIuLG1ɺ1H5H(D[]A\A]A^A_ALLG1ɺ1H5qE1f.LG1ɺ1H5A_ff.fATISH HHAu*-Dt tID$It A tHL[A\ff.fAV_AUATUS H_HI HHt1HVLHHI Hu:H I9uL%LL HuI\$ LHu IHLE[L]A\A]A^E1UHAWAVH`AUATSHHdH%(HE1Ab H`L5HH`L9 IFHHH%H)HH9tHH$H9uH)HtHL Ld$IHKT4I9sf.I$IL9wHDžPE1LpEfLH HHHXIHPLMt*& ILHI9sLHHH9wL HXH9w9DA)AA u@IcHPHJUDLHuH.A uE~EL11H5֠A 9HHHt$KHxHfHHH9wEt1LI|HA9HEdH+%(u]He[A\A]A^A_]HpI&H7HHs됐HHHS ff.AWAVAUATUSHXt$H$dH%(HD$H1tP8 AHD$HdH+%( HXD[]A\A]A^A_f.H$HIE1H-UL-HHH=HI9= 11h HH(E1Hu,fDHH)L9HIL9vH5=L)L|HuHЃL9gHxLAB3y D\$D|$H 7HD$HEHDHD$ HIHHL$@HT$8HHHD$uM~A?tLLHQMvMuHL$ H|$(HL_H$II)L0AUD$;LHPD$BPD$IPIHIjr(QH WPLL$H1UDD$XH@LH|$8EfDI\$VfDHHHV HH^Z; 8L b1L$@PHQH5@P-[81ɺpHPHL PL?1E1t[]]D8\1ɺkHPL L?1AU5A^A_8 L a1Lm?PHTLH5PsIL:H1D$HSLL$LH1AYAZkD$L \eD|$HHLLEHHD$01KZY4_ 8+;Iٺ2IH H`HEHH 3APLbQPH1H D$L5aL=HAL9M>ILLHtSL߽AWLL$S LAWLL$S LsAVLL$83;Iٺ-IH H_HEHH 2APLjQP^eHE1LAWL AVMAUATUHSHHdH%(H$1HLL$@Ll$@HD$HHLd$HD$PHG8HD$XHgiHD$`HHD$hHHD$pHGHtHD$MLQH5P1AYAZD$H$dH+%(HD[]A\A]A^A_@HCL =HPHHEHtLH1RH5LfL^E1_DKLH~=1HD$ELL$PLH-01H9r2HSHBvAA CP1CPLL$zL u)AΨu"AtuDrADLL$VL;LL$hL MnHSLLDHt$MxH- L61ɺsHiH-Lo61ɺcHBff.AUATIUHGHWLH@ 1H5}L{HE@ t%U82HE@t U<EU@RUDUHt1H5OLDLAT$ tiHHL]A\A]n*fD1H5L_U8uXHEHkL@HrHEIAT$ LuL51ɺi1H5TK]1A\A]1H50L?uL41ɺH57 f.1H5LL41ɺH5x1H5LLC41ɺH581H5L`L41ɺH5sHL31ɺH5L!@1H5PLL31ɺH5 1H5LL[31ɺH5˞PL431ɺH5y)@1H5CWLo L21ɺH5c8L21ɺH5<ff.AWAVAUILATUHSHLHdH%(HD$1HL|$PLt$Xi H4$HFIHFIHFHVHtZ1HtSH91HfH*HfH*^Y,ȅDAMHt$SPHcHHaw̫HHHHAf HD$dH+%(HD[]A\A]A^A_fDALi111H5ܜf.HуfHH H*XHHƒfHH H*XfDAWI1LAVAUIպATIUH-6SHHH(dH%(HD$1HT$LLg hHt$CL9F HHoE1a@D5O`H@LtIFPH8ukL3kLIH1E1]Ht$L0e HD$dH+%(H(D[]A\A]A^A_f.HE1E11j1LjjH mCLAD9H4@L!H1E1HDKLHHD$L@ P1Ht$ _AXAL /1H1PD$ E1DHE ^KvHLhIEPH8u)LiLIyHE1E11j1LjjH tHt$HF0B<0Du IM`D$ AD9{LaD$ A'I}P1H5"t)Ht$Ht$AL-1ɺ11H5zAWDyAVI(AUMATAULSHH|$N HfHH|$(KL=+IHkHCLk N HtqfKdLH@ II>HPHhtqIVL3HSIVHI>I^tUHXIVL0HIFH[]A\A]A^A_1LH5 1s AWAVIAUIATIUSHHH1ɃIILLI)ىL$ Iǃ,t1A?:tIH[]A\A]A^A_I_H4L$ IILLI)Iǃ+NtA?:tI_f1uI_H1IغILLHI)fH]Xf.AWAVIAUATUSHH(HH4$dH%(H$1HbL%1 L> LH輘 HH0H@HD$HH<$L$HL IH!Md$M$$I.@ HHfInI@Dh uE>L$ED$MMIpAfAAwՃA:@LXHfED$AH<$I(M)iK H`DfH LhH4vI>H4Lx HpINL0HHINHIFL}EHL}HEBDx uD}IH$EtnHfLxHfE(1ɀ}:AH$H<$LL$E}DI녃|$M9M.Ll$M9u\ 'MmM9IEuIE1Im L=ncMuI9HEH|1IEH|$I :LHH9tAGtH@H9uA<suLLuHHbHDIEP w4Ht$Ht*HF86HH5HpIEfM1LګH5 )@IEHI9f.HP !#/H@I9HuMmM9}HD$-L ^A-A-MQ;Qt#I΃ 9BA9DGI9HHHH9uL9HrHAD!I9tHHL /M9 mHtHN / xLJL\@H=HxH=HxH HHMH<$LE1n[ H$dH+%(\ H(L[]A\A]A^A_f9FՃEI9HD$E1A1۾;D@A9t91ۃ HI9HHQAAutAt E9pEE1EAfDHD9?AA1i yHz }LRLfH<$2F HD$HHD$HHHHHL$ H5ʒ DDL@t$fEt$H.@IMH$H$1A-L MIH9 Hr I9p LJMPHJ1LJ1LH50L1 H5H<$1X i-A-A-H|$Ht$0foL$0foT$@fo\$PHD$`M<$)$)$H$HDŽ$DŽ$)L$pM9b1Al$1Dl$LMMDt$I\fC CHct$HH)HHH)H9HOHiҀQIאI$LI9IID$CvCу w$DI|$ 1IAOtitSIIڃIDH낍CvS n eH5>HcH>IQLDA-l$0D$|'HD$p0D$x 1MLڤH5˳GMl$Dt$LDl$A)A*A#A-A!H|$pH)HD$ HD$(H$H|$ HB$t Hl$ H|$(H!$<H\$(Ll$ H<$LH$V 1ILH H8 HH<$HXHA IHC3$A$DfAD f.?薌 HHHcLt1 H5NPL&H-1E1H$L113HtDŽ$D$|.LRMHHJ1wH|$pD$pH)HD$ H;HD$((Eك-JH|$pH)HD$ HD$(!H=HD$ H*HHHHH?HH)Ћ$)H@H$H)Ƌ$xHcH9~  $)%HHB8l$xHiŀQIHHBP 'IHiIHiŀ: Il$p)$sl$tjIbHHH)MxIHD[A\D1ɺ0E1LH5#FHD[A\ff.HHH@8  =M ff.fHHHP8M @AWAVIAUIATIULHSHLD$9 HHHHIH@H9uxHH9thLHL*uL1ɺ_H5GL11gH5&H1[]A\A]A^A_DHD$LLLAHGH[]A\A]A^A_鲝 f1 LH5L1bH5zmHHIGAD @ATE1IHUHH11HXHt(HHLH]E1H A\ f1L1ɺVH5H1]A\DATE1IHUHHչ1HZXHt%HHLH]E1H _A\v fD1L:1ɺcH5aH1]A\DATE1IHUHH1ɺHWHt%HHLH]E1H 8A\ fD1L1ɺpH5H1]A\DATIԺUHHHSHAL1H@PHDAABWHtHGL[HH]E1A\a 1L*1ɺ}H5Qo[1]A\ATIԺUHHHSHALùH@PHDAAVHt"HGL[HH]E1A\Κ fD1L1ɺH5[1]A\AWAVAUIATIUHSHH8LD$dH%(HD$(HAH@H$< @HXHHHXI5 IHH@Lt$HHl$H-HD$Ht!HM1H3, H[HuHD$E1LLLHG轙 HT$(dH+%(mH8[]A\A]A^A_f.HBf5@,HHtHH9f.HD$HT$E1LLHT$HGHT$' efH34 IHGH@E1H&Fn @>OHHHHw1ILbL1ɺ1H5TpqHD$(dH+%(HD$LLLE1HGH8[]A\A]A^A_ f<1҉ILH=B<A1ILH=dvHH @ ff.AHօtQ y > @ ff.U1SHHLTHsLHI 衄 u]L1ɺH5=HD[]A\A]1ɺE1LH5 HD[]A\A]Ã+HD[]A\A]*x f.UtLZSHFH!Ga u/F=ArHD[]At@tHGHDL$Hxj, _AXIL{1H5HE1D[]L1H5HE1D[]HGHDL$Hxj>, HHCDL$Hx$, LAH57I1H,$YE1^HGHDL$Hxj+ LIXZAWAVAUATUSHH(DG`AA9HGHx)D9H{DHGH@H@PHt HЅHHEDH(aHHEDH|9LHHD$I9H\$DMeID$@A$HHHH9HrI$ADH (ID$@HzHHnH9eHrI$ADHƘwtM$I$I9uDM6I9I~ uID$@HHHH9HrI~ADH`HID$@HHHH9HrI~ADH-軒c1ɺD$LH5O DL$fDMmL;l$dAH\$HHHD$H9uDLuADH&IvHI~p,[MIHD$I9Hl$IvHI|$ ADHIIvHI|$$ADH8ÑIvHI|$PADH%蠑mIvHADHI$zIvHADHI$dTAD$LE1t=DI$H@HHڋHAE9l$LwM$$L;d$Hl$HmH;l$fDAH(D[]A\A]A^A_LL1H5Y%E1뾉D$L1ɺH511DL$@H51>@H51s@H51Z@H5y1@DH1HH[L>1H5qE1fD$L1ɺ;f1ɺD$LH5LDL$D$L1ɺD$L1ɺELH5E1V1ɺD$LDH5ķ蕾DL$)1ɺD$LH5hDL$IvHHzADH贎1ɺD$L H5HDL$HzIvHADHHZI$IvHADHH|H+1ɺD$L? H5落DL$$1ɺD$L H5cDL$1ɺD$L H5e6DL$1ɺ D$L H58 DL$D$L 1ɺ1ɺD$Lt H5żDL$Y1ɺD$LG H5ǵ蘼DL$,1ɺD$L H5kDL$AVAUATIUSG`HGAH@@`tu(E$[]A\A]A^@AI$M$L9t1H{7;HL9uA9sI$M$1L9tDH{:HL9uH;1AAVLH5tX1ZFL1L+,H5q=[1]A\A]A^f1LZ5H541fHG`trHGH@@`tuHÅDA9vHW1LRH5yX1ZL1LHH5yE1HfDy1LƄQH5<1<SHHH?dH%(HD$1 1觬AXAYfDC8茳L =1L PWHYPH5 1[AZA[f1Lq8-lL 1PHLh PH5 1XZu`AWILAVAUAATIUSHH5JHHdH%(H$811҃" P1TRRq}(AXAYIHD$L$HD$cDLB1TDž@EEAELLKCE;x蟬tA>M1PHEuH5IPL 1趪^_W ;u;;;\ED$D$,;D$DL$;(Lf1H5mH#;̫11ɺL H57H1H$8dH+%(HH[]A\A]A^A_fHt$;tHD$H9$HD$H9$21D $L DT$H5 KDT$D $DA>0M1PHCLo PH5JG1XZ@A>A<$MIH HbBHDHH }oxAPH5FLUQP1蠨H 1DED腯A<$MIH& HAHDHH APH5FLTQP15;H ک舲UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$E1x"HHH9wHH9tH)HEAHHD$dH+%(u HD[]脱@HUSH-.tdHo{HH)fDHAu.t_t +uI:Hu=DH[]DGt <.uuH[]ø뺸UHSHHH菩tKH HHwt3HLqIMu!H[]fDIٹLq1H5BO詥H1[]UH5Ht3H5HߨtH胠]H]fATIUHHHt"LH IHt7HL]A\@HHT$[HT$tRHuNfH!LYIH5LN1豤HL]A\fDHHT$uHHE`HH!H9tH.Hn:H/Hܒ(H4HH%rCH&HmH'H@uHT$HH7HHHLf.AWAVAUIATIULSHH(D}LH Lt$`LT$hLD$pDHHE0% HHE]PH@P99AsA0EPHH9`H9UL$HD$Hz)HjDLD YL^I1ɺH51询L$fLҾLb+ HHH)L1$IH^E1 u $fDL(' HHH5K1ɺ1L H5*tL 1ɺ1ɡ@1HuaHuLHFPLNHLփL4`H(EL[HL]A\A]A^A_s11AfDLEHwxLA@a HEHL$IHHE#LmLHHH52s1H4$۠H4$f6Ld 1ɺy1H5r觠fLLD$LT$H$u H$LT$HLD$HLD$LT$H$HD$裋HL$uLLD$LT$H$H mfDL 1ɺiH5MrH(1[]A\A]A^A_1L H5HLl 11|H5r诟DE1 v$0 $_LHL${HPIHHT$H8D HL$HH+HT$LFHL$H$t|H5_vL5HL$H1A$Yh1HQ`AlDypHAx[Lk1oH5q贞I>A}HWtLHL$  HL$HHǂHLHL$HT$] HT$HL$PH5?GL 1ɺ+H5kp<H5 GLSu1HǁH5(p@H-p1HL[豝H11LB JH荝HLiLHHmH}LjH5oIHEH@PH/11ɃHEH@PHM1H5ELiH5oDUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$D$0HD$Hl$'@ƒH$H2Ht.H%HHu$/vHT$H2HBHD$HuHD$dH+%(u HH[]-ff.fATI1UHHæHt>H_葡HHtYHxLA1Eu EH]A\fE1Lkh1ɺ8H5D+H1]A\ÐH1]A\fDUSHt[Ho薠HHBu6.t1_t,Cըt%/t =t!t:t&t #u]HuH[]1@ATSHH=M^tAHD[A\f.H=E1ѣHuH^HHIHt7HLuH=]E1H]|L%Nq1ALLLqəL1LKqK詙Lf1"H5p|AU1ATIH=qUSH1H\HLlj腜H9u(AӚHD[]A\A]D賢L-ap8HL pPH7|LPH]2L1EP1蹘H ^AątL1L> 1ɺ~E1臘HD[]A\A]fE18aHL pPH_LDwPH1H5oP1!H DH[]A\A]1L 1ɺH5VoHD[]A\A]f&)AUL5eATD .L%56\ULHP(P(P2AP1z5$AH u(p(t ]A\A]DHtL t@H_MV91]1Ln1L 2(tVl1H6tH^[]LLN A\1ɺ0A]閖fD1ҾH!d u=tL-su#Hh"H4nL 1L1HsN՟8L s1Lk PH\'P1LXZf.諑fDH PLc]LL ]A\Lc1A]C鄕]LLamA\"1A]_ff.@ATUS6,11HrÃtD%qD9V[]A\f}tLJ 1PHlL PH5W31Ô_AX[]A\11Du8HAٹATH53Lb}Y^[]A\fD}hHE1P1LbH52?XZ[]A\6%ATIUSuHH5lL艞tEM1LbH5u2ޓ*u[s=]A\H0HHHH9t$@H]H0HHHH9uM1LbH51d$OHwdfSp11蚙u6AٹLaH51[)D蛜8HA1P1LaH5R1軒XZ)[ff.fATLaIUH-1gSHHD b)dH%(HD$#P#PX#P;P19;H t5# g#tHD$dH+%(H[]A\HnH$L nHtMu8HL]aHP81軑A[[^;@11Li>H苑A$upHLu1ɺAHL QD~Ete7(tE" w"uH=~_CH1L WL_=Rn腒ufH=2nŕL%.nH$HnI9aіHLH9vnHHMSLH`1ɺK1r^_&8_1ɺFHPH*+L mPL 12AXAYXHP1SML>`HZYeDHC&t  !t HfDHwAWAVAUATUSHH $HH $H8HT$HH։dH%(H$( 1D$HtH HD$ E1E1Hl$ A L-IAAFH IHtIcL1LH)Hw yL%TeI11LgGL̎wŃSHt$11҉ԗA9D$AAxHD$AHt fDH$( dH+%(H8 D[]A\A]A^A_@-%t+ ]tsDlEtwH D$ HHl$ @蓗E18ٔHALPLo^1[豍_AXIf[fKfHD$L HH1LRLeh1KY^@<1E1L]H5c@LDeL1E1a苖E18ѓHL yPHdJLPL91AQ蛌H 2H1LdLRjmXZіH;H8HBL LIHH%A9HOdARHDAPLt8SUP1}H ff.@AUATUSHHdH%(HD$81HD$HD$HD$ HD$(D$0D$ pu#HD$8dH+%(HH[]A\A]@H=c˔HHHcHDHH1-Aău=DMAL-cpL1L2\XE1ҾcZDbt}L-2c蟑1LIPWHb%PL 1vY^oL-bL*[1@LAH|$ǐ/|L1L bHl$ LbHIHu PHLbPH bHbH5bHD$(PH|$81^H H|$1HT$ H5gjDL$ ETH,H|$BH|$(DMAAoDL-a}0WI1PH#LPLk 1XZALaL1x݈UH59ZHAuMH5NZH.u:HLa1Lt$0L i耈_AXHL iL1t$0LaAAYAZL1LZALYL1NL-g`1LXQL蹇Dahlf.DHHBHI`@( H%scH3sDH ^HJHJ t"LF1ɺ 1H5Z7HDH mHJHJ tH HJHJ tff.HH׃Au5HHrHaHDH qHxmHDHG HWHHaHHKrH5>rHDH1rHDpS HfDHH׃Au5HHqHoHDH1oHDpP HfDHA`H׃Au8HHnH?^HEH H|HEHG HWHH ^HHnH5nHEHnHEO HfDHHAHHAH91fDHPHHHH9uEu;Hr]H#nHEH5H.iHEHO HfDH7]HmHEH5mHmHE O HHmH5EtH5m@HA`H%Au6HH|mH\HDH bHxHDHG HWÐHH\HH;mH5.mHDH!mHD`N HfDHHHA`AH rĀtz%u9HHlH\HDH5HgHDM HHHlH[HDH5lHlHDM HfH5_H`ltH5OlDHA`HHAu4H+lHl[HDH HJgHDHG HWHH=[HkH5kHDHkHDM HHA`H%@Au6HHkHZHDH HfHDHG HWÐHHZHH[kH5NkHDHAkHDL HfDHA`H%Au6HH kHMZHDH HHfHDHG HWÐHHZHHjH5jHDHjHDK HfDAH׃yHt(HijHBHYHB @HHQPRu:HAjHYHDH5eH HD_K HDHOYHjHEH5iHiHE%K HHHBHYHB ff.AH׃yHt(HyiHBHXHB @HHQPRu;HRiHXHDH5dH1HDpJ HfDH_XHiHEH5hHhHE5J HHHBH.XHB ff.AH׋QuGu#HhHGHWHG HeHGHWHG @HQu5HWHEhHEH52HHEjI HÅHhHXWHDH5gHgHD5I Hff.AH׋QuGu#HgHGH WHG HHGHVHG @HQ(u5HVHegHEH5RHbHEH HÅH7gHxVHDH5gHgHDUH Hff.AH׋QuGu#HfHGH)VHG HHGHVHG @HQ,u5HUHfHEH5rHbHEG HÅHWfHUHDH5?fH6fHDuG Hff.AH׋QuGu#HeHGHIUHG HHGH&UHG @HQu5HTHeHEH5H@HEF HÅHweHTHDH5_eHVeHDF Hff.HAHHPAuHu$HdHGHZTHG HHGH6THG @HujHdHSHEH5HHEE H@HHHH9 HAHP6fDHSHGdHDH54dH/dHDlE HfHHQHHR`H%syHtYH0sxHttAu"HcHGH0SHG fDHHGHSHG @HAPHF_Lp8@ f.H@PLH_@o ff.@HHH#A`Au9HH'cHhRHDH H^HDHG HW@HH5RHHbH5bHDHbHDD Hff.HA`H׃Au8HHbHQHEH tHupHEHG HWHHQHHKbH5>bHEH1bHEpC HfDAHHHt*t$H=QH ]uBHOHW @HaH H5atHB H@H5aff.@UHSHHHAH@`@u tyHt$HUHEHPHE H[]fHAXHlDHAtAH%At4H Et(JL11H5t1uHH;HH[]Y fATUHSHAHH@`@u tyHt&H[HEHOHE ]A\fDHAXL%yDHEt.L%mAt!L(1ɺ$1H5~tH;L[H]A\ ff.ATUHSHdH%(HD$1AdtHHHuiHAHEHE HE@( u"HD$dH+%(uNHD[]A\fDL31ɺ 1H5G@H$H;H A~UHHHQ`u tLAtaHtWH`NH5ZueHE@ H]f.HtH$sGAH$r}DH^H5tH5^DH5^HLD$LD$Au\Hs^HMHEH5YH+ZHEDHHxHH9hB3^H^HXMHEH5]H]HEDHA`ATIUHH"SLrlu=u$H]H5L> []A\@H]H5]Hu?tHLH5FYHuHT tt DtH}LH5(]sfUHSLHHuAH0LH\HHDH5HHD> H[]H\HKHHEH5\H\HE= H[]fDAu&HO\HBHKHB H[]@H%HBHKHB H[]ff.UHSLHHuAH KH[HHDH5WHHD< H[]H[HJHHEH5z[Hu[HE< H[]fDAu&H?[HBHJHB H[]@HHBHvJHB H[]ff.AWH AVAUIATIUSH8HidH%(HD$(1 HE1HHfDH@ HEH8L}`pA UHU`- CEtA-DsHE`@%HmCHHCh-CHE`tH%SHE`H$H%-SC-HE`0CpHE`HH!HƒkC ID$I\$I\$ @( HT$(dH+%(H8[]A\A]A^A_D=EEuEA}H E]EEUsEuEM(aEu A},iCEE(Et A}H HE`H%s A}H/H0s A}H@{rt Au$tCRA}ྃoHHuAUH @CXHE`H$5H-rH4rH0e@CSHE`H$HHH9t9Ht4HHtHHH9t HH%-wHໃr[pHBCHE`cA@HeIeI(ZI!OABICM!*AHgAI LH< R@CXXcf.1L*1ɺ H5$>^@HHDETHHH9LHCz-DIUPu)CMHE`fIMPQ8CFHE`foAH OfL( 1!H5Li1L 1ɺH5 =+i1@ HyHjiCrHE`HxCDHE`HEcHuHE`rHHqHmHY PHst H$6)HHHrH~5HH9uH<҃ⷃv@1fDHHULtkIUPBɸ¸뻸IUPH:CEHE`HE`H rJH)s+CwHE`C--5Q0}H:qCRHE`dHt$HtH|$t CmHE`>Ht$ Ht|H|$ H5NblqugCsHE` IEP@A}CSIEP@8A} CCIEPuHHH9|rLHH@HHHLVHRHH)fHH9HPBgt9A}tCMCI^pCmuI1/LH< MH/thHHH9t/HPHtLzMtHRXHt AGbtH9t8HH9uLMHL6O1H5CeItL!THHPH{HHH9EH<pLIkHI~L;yID9wLJHuHAwHLSN1H5dXZ^I$sVAtHOHH6HH9&H@0%HSdA@mDM_vAMI%t=I&T-AI"r9lAHHtI$skt4oHRHMBiHu-H-iH SsViHHt$ HT$\HT$HD$ 1LQLH51F 0uH1AwHrHAVbHD$@H B<0A:LJHuHAwHLmKMOHL-KQuHPE1LKuHH5AwHrHTbH IfDAUHATIUHSHH HH H}@AH9ufHH9txH;zuL HL1H5Ha1LR 1ɺH5y5aH1[]A\A]f.Lc HtaHH҃ⵃxPHH҃mPHCHC HC@( tI1L 1ɺ H54H[]A\A]1@fPduDH[]A\A]E-uOшAfUHHSLH( u?Hf;HLHHDH5dHHD9- H[]DH';HKHHDH5KHKHD, H[]fDu'HKHEH:HE H[]DH]HEH:HE dff.fATHIUHSe HlH1HfCCHE`%HwHE`HೃzCHE`HൃxCHH9O1DHPHHHH9uགྷpCEP*(&$-ScEatVCID$I\$I\$ @( u[]A\@1L1ɺ H516[]A\@H-Ht2?຃sDL1H5W]1Lv 1ɺH51][1]A\@-1@HHTݸָϸUHSLHHHt4_>t+H<8H5Du4H* H[]HHH5tH5HH5HUHSLHztFHAPHHt =u-HfHuuHH5K) H[]fu'H HHEH}7HE H[]DHHEHV7HE H[]fDHH5G) H[]ff.fAUATUHSHHHQHB HtHHtHI DLj(L`HL`L蝾 HtXLLHAiHCHC HC@( t"L#1ɺ 1H5&/`HD[]A\A]f1E1LBH5 /)[HD[]A\A]ff.AUATIUSHHHAH@uVHAHCHC HC@( t"Lh1ɺ 1H5k.HD[]A\A]a L-tAL-˲ t0LXD1H5&6ZL-!I<$H Ht~tAMHCAHC HD[]A\A]f.HHHH9$pHAH@fDV1E1LH5>-xIUL@LIHIT-HT(HL)H)G1L 9M 89r,f L-KAMALLALfL@ATHUSHӋQHVAH-qL蘻 HDAHUL@IHDHLHLHHL)H)Dr1L 9M 89r8uHHCHC HC@( t"L1ɺ 1H5+ []A\A&tMtLfLHAPH@hHMII HHLHE萺 HLA1H5sW}HAPDH4AwJAAA H-AE1H HSAHEOd$HnfDLIA1H55V1L 1ɺ H5*V1@MLLmfDAUATUHSHHHAH@ tgHBfLAL-#uWH}LK HLLHTdHCHC H[]A\A]@@uAL-κ@A L-tA L-x1E1ZL`e@@AHHH9tHt$f1L VH5A){H1[]A\A]fDA L-ofDAUATIUSHHHHt}uJAH-չI<$L HtL HDAAHCHC HT$dH+%(H[]A\A]A^BAL%wtHtHAL%Z3XHE`H AH)A L%L31AI>L%دL H#1Ly VH51#I$HxHHKT,JT(HH)I)D1ɉ΃M4L79r@AL%`1~fDtyAH6HAPAL% H8B DA $[ALfLKAL%H%AHuUHQPAL% KB8A L%1B0AL% ^fDH9HCHC HC@( t"L 1ɺ 1H5MAL% +fDA $ALL?@HH͒H<$AL%0CSAWAVIAUIATMUHSHHHHH@LxHLMLL`Lf HHL1HIL H |MH,kLH1踡 LT0L'MLL`L HLLHVHLH H[]A\A]A^A_HulL{HLA$ t^LLLL`L胪 HHusLC1H5IgGH1[]A\A]A^A_fDHSHH}HL[]A\A]A^A_r fLm/ DL1H[HL H HHH9t(fLHAAt LMuYHH9uHbHBHB HB@( t@H1L31ɺ H58rHLfHA`H-rH%s2HHH9t&Ht!HHHHt=D@uHHBHB HB@( t8H1L1ɺ H5·Hf.HA`H%rH-s*HHH9tHtHHtHHBHB HB@( t7H1L1ɺ H5!Hf.HA`H$rqH0rj HHBHB HB@( H1LR1ɺ H5WHHHH9ZHHtHHH9ZHHH@HHH9ZHhf.HA`@uĀt#HHH9^ZH8tIHjHBHB HB@( tPH1L;1ɺ H5@zHHHHA`tĀt@uff.SHHHH9t#HfHPBt HHuHH9uHfH HtBHCHC HC@( t"Lq1ɺ 1H5t[1L: 1ɺ0H5aB1[ff.SHA`HHH-rH%ssHHH9tgHtbHHpHtRH 2HtMHCHC HC@( t"L1ɺ 1H5[f@uHLl 1ɺ0H5A1[ff.fSHA`HHH%rH-ssHHH9t`Ht[HHtOH fHtQHCHC HC@( t"L1ɺ 1H5[fDHL 1ɺ0H5@1[ff.fSHA`HHH$rjH0rc HNfDHCHC HC@( t"L1ɺ 1H5"\[DHHH9VHHtH 4HuL 1ɺ0H5@1[@HHH9VHHp@HHH9pVHh{ff.fSHA`HHө@uĀt#HHH9/VH8tJHHCHC HC@( t"L1ɺ 1H5$[DHpHF`tĀt@uH Hu1L 1ɺ0H5>1[ff.ATHSHHHHtu]Hq 褱HtaHCAHC HC@( t"L1ɺ 1H5UHD[A\f.HHHq CHu1ɺ E1L H5 >HD[A\ÐSHHqHHHtHƨHtDHCHC HC@( t"Lc1ɺ 1H5f[fL, 1ɺ0H5Nq=1[ff.fATHSHHHQPHqH- HtMHCAHC HC@( t"L1ɺ 1H5HD[A\1ɺ;E1L}~ H5 a9H1[]Hh@AWHAVAUAATUHSDHdH%(H$1҅t]HPhHtTD:LrI9tHHLD| HH`Et[uVDADLHrAąAH$dH+%(CHĘD[]A\A]A^A_DH(AąuLy 1ɺ1H5" @8fDHHH`AHH$szHHH9NLrXMLME6HR`H$Ldy 1ɺ1H5 7fuLrXDH$^L y 1ɺ 1H51 E1L7AfAWIAVAUAATUSHHxDD$ dH%(HD$h1DLzpHjpL93Dl$ Lt$ A6fEu90HPHDD$ AąM?I9IGuHHL@1 HHH=AąIG@AHHHL$LpH9t{HD$ HHD$fDM~pMtMH|$L1Ҿ@ HHHDD$ DLHIFxLpH9D$uAHD$hdH+%(sHxD[]A\A]A^A_@HHD$ LHD$I9ufDHmL9HELPABdtIIH9 LL9xXt L9uH|$L1Ҿ@LT$ LT$HHCHLT$LT$ODD$ 1DLH]1ɺ}E1LRv H54fDEIMI9D|$ Lt$ AHmL9HEtEt1HHL@ HHHHE0HPHDD$ u1ɺE1Lu H53Llu 1ɺb1H53f.LM 89r~f1L H5n1hAMALL= ff.AUIATIHUHHdH%(HD$1H$节uEbuXLL u (fDHHH$HtԋP LLv HT$dH+%(u1H]A\A]@HH1H9HDHH$ AUIATIUHSHHY`dH%(HD$1H$H r:H eID$H_ID$ HT$dH+%(ulH[]A\A]fHxtHEPH H8sHH蛂tH$LLr fDHAPHHH8 uH]``, ff.AWMAVIAUIATUSH8dH%(HD$(HA@ HHHVb IHH@E1H IElHD$(dH+%(IGLLLH8E1[]A\A]A^A_fDIGHT$E1LHT$HT$HT$(dH+%(oH8[]A\A]A^A_@1ILH=E1ɅA-1ILH=DL$ wDL$ uA  1ILH=(DL$ 1ɺ< H5%C1}AUIATIUHHSLHdH%(HD$HA`H0rjH%rH-s<ǑHILLHH$?HT$dH+%(u\H[]A\A]@HaaID$HID$ HHH9HBfnwff.AUIATUHSHHHHt0uoHHCP1HH8IHtoH^ HHtZHHtu8HHLLH[]A\A]H@HPXfDH@H@XfD1L H5VtH1[]A\A]AUIATI1USHHHHt8ueHCP1LH8$HHtlL] HHtWH1Ht0u3H HLH[]A\A]DH@HP`fDH@HH`fD1L H5nH1[]A\A]ff.@AUH_ATUSHHLaPMtnHy@HHt mSuQLAHLhL] HtuLLHHCHC HC@( u.H[]A\A]DHQHCHC HC@( tLp1ɺ 1H5sk1LH5fH1[]A\A]AUH^ATUSHHLaXMtnHy@HHt mRuQLAHLhL\ HtuLLHHCHC HC@( u.H[]A\A]DHQHCHC HC@( tLp1ɺ 1H5sj1L(H5fH1[]A\A]AVIAUIATUHHLSLH dH%(HD$1HL$HT$蟩tCHGE1LHHT$AHD$dH+%(uTH D[]A\A]A^fDAIFPHzL1LAvH1H5XZDAVIAUIATUHHLSLH dH%(HD$1HL$HT$ϨtCHGE1LHHT$AHD$dH+%(uTH D[]A\A]A^fDAIFPHLLAvH1H5XZEDAVAUATMUHSH`5dhdH%(HD$X1D$ D$HH\D$ uQA$H#H5[HTHD$XdH+%(H`[]A\A]A^fDLsPMML,ID$ ,L ~:H`H#C`&Ll$H{ @LhetrHsHLL$LLH LD$  tpD$ A$HFH5fA$uH&H5L6 1ɺ H5ҿA$uMHHEHHE vf.A$GHjH5[BfDH=[HEHHE )DD$ A$<*f.HAHH@H)rzH*r#HXHGH)HG HXAukHHHDH5HXHDHfDHH@HHH9; HAH@XfH7HxHEH5HHEUHff.HAHH@H)rzH*r#HWHGH)HG HYAukHHHDH5HWHDHfDHH@HHH9E HAH@XfH7HxHEH5HHEUHff.HAHH@H)rzH*r#HVHGH)HG HZAukHHHDH5HVHDHfDHH@HHH9O HAH@XfH7HxHEH5HHEUHff.HAHH@H)rzH*r#HUHGH)HG H[AukHHHDH5HUHDHfDHH@HHH9YHAH@XfH7HxHEH5HHEUHff.HHBxHHDf.HGH@HGHGHG(HGHG HHFuG3u'HWHB HtHHt HB(H1LHtHGH@(fDF$G$FPGPf.H(dH%(HD$`ttHT$dH+%(u:H(HL$ LL$LD$H5rplHAH@H)r=H*r&H'SHBH|HB f.H$@HH@HHH9HAH@DHAH@H)r=H*r&HRHBHHB f.H`@HH@HHH9}HAH@DAUATIUSHHHAH@H)9H*rRHRAHCHC HC@( t"L1ɺ 1H5!_HD[]A\A]D\Aw}EH-HKAHDI<$LO HDAANtMMHCAHC HD[]A\A]A H-AtL.1ɺ[1H5HAFH- KXf.HH@HHH9HAH@fV1E1LbH5]HUHxHHJT-JT(HH)H)D1ɉ΃LD5L79rAH-fDMLLLfLUH-f1ɺDHL1HLO]1ɺ1fHH5\Hff.@AW1AVAUATUSH(_L;^LuvN8II9O8uhtsLL@1I=DIHǃ?u9HMDAwPHOI9Hu"Ap;wuHL9t!A<tf1H([]A\A]A^A_III1HL$IHD$HT$H9fHH9D$uH;l$ HD$1HH9u19uHL$H9L$tTHD$L`HD$H9YI@MmL9CIuLuHD$HHD$H9D$uAF$AG$AFPAGPtZH[I1HHH9t6<uILDH|HDOEHLHIxLH9uH([]A\A]A^A_H;l$1fDHH5THff.@AWAVAUATUHSHH5ZHHhdH%(HD$X1HT$PLd$ L-311fLL)D$0)D$ )D$@H\$8CfH)D$0)D$ H\$8)D$@1LLCHt7H@ Ht.8GML11-H5YHEL . HPHHCHtLHLR3@L-j1LLBHLH訕 D$ IHL=_f11LL)D$0)D$ )D$@H\$8BfH11LL)D$0)D$ H\$8)D$@vBHt7H@ Ht.8ML11-H5XHEL - HPHHCHtLHLRF@ALF1-H5")HD$XdH+%( HhD[]A\A]A^A_HEL =- HPHHCHtLHL2RCH51E1ZYDHEL , HPHHCHtLHLR@DLhA}1 LLHd1H\$8@HuRD$ DHEL m, HPHHCHtLHLR<+f.HEL -, HPHHCHtLHL:R9f.LxHEA?H$H$LL`PLgHLpMLLFH LhMD$LmXLLupETILArcuIM`H}D$ HO`uJIHExIHUxIAHIHIHEHM0IM`I@u}Hg`H$HSHHHH* HtHQMLRPIf.H$HSHHHH* HtHQMLrPMKLmh wr fUfH1SHHHHdH%(HD$81H)D$H|$1)$)D$ f>HtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL ) HtLL1@H5^9E1ff.@AT1UHH5ESWTHHHCXH5|HHPH1AąHCpHPHC3t4H5H1AąAD[]A\f.H5H1AąuL# 1ɺ[1H5PWDAL" 11ɺWH5%,D[]A\@1L" 1ɺXH5D[]A\L" 1ɺ]1H5(f.ATUHH5SHHHHPH1HH5H1AąH5H1dAąHHt HPHH5H18AąHCXHt HPHH5H1AąHChHt HPHH5H1AąA[]DA\DLT! 1ɺ1H5ӌD[]A\AL!! 11ɺ H5dD[]A\@L 1ɺ1H5s7DL 1ɺ1H5Ksf.L 1ɺ1H5Cf.Ll 1ɺ1H5f.AUHATUSHLHdH%(HD$1HHl$@Ll$HU H$Pt2AHD$dH+%(pHD[]A\A]@ukHHUHPIUIU@Ht H;HH9HuWA뛐ALy 11sH5qAYHMHtM1HtFH9Hx}fH*HxOfH*^Y,tz=D‰AAHЃfHH H*XDHȃfHH H*Xnf.댸-ff.fATUSH D%MNdH%(HD$1Et/D% HHEtFD% Htx EHD$dH+%(H D[]A\fHLL$LD$H5 )  u MHL$HT$Ht$ H=xt <$ A HtH1E3' D% D%MEHL$HT$Ht$ H=AD%B < uD$ b tUL1ɺ1H5pfDLy: 1H5u |$LC: 1H5? Dff.AVAUATUH(D% LdH%(HD$1EtG D%< t$HD$dH+%(H(D]A\A]A^ÐLt$Ll$ Hl$ LLHH="Aąu D%fD%yKEt$LLHE1H=tHA@L99 1H55 |DHGHIHWpHp0HGH@PH8Df.HGIHWHHp0HBPH8~Dff.HGHWpA Hp0HGH@PH8 DHGHWpA 1Hp0HGH@PH8X HGHWA Hp0HBPH8) fHGHWA 1Hp0HBPH8 ff.AUL-0 ATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLH誼Aąu1LH5HD[]A\A]ÐAUL-+ ATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLH Aąu1L]H5[HD[]A\A]ÐAVL5 AUIATIUSH*H9tgHL5m  HI9tPHsLLuL5C HmI9tOHuL#uA[]DA\A]A^DLLL:Aƅt[I,$L5I9uLLLAƅu1LH5c'[D]A\A]A^H-CL21HH11L [D]A\A]A^AUL-WATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLHAąu1LAH5/HD[]A\A]ÐUHH0H]fDUHH0H]fDATHUHHIHtrHmHID$HID$ Hd ID$(>ID$0Ht IL$ML$(L11H5-4HL]A\L 1ɺ1H5fDATH IHtNHkL 1ɺID$ LHID$H5¿1ML$(LA\L1 1ɺ1H5tfATH{IHtNHkL B1ɺID$ LpHID$H521ML$( LA\L 1ɺ1H5 fATHIHtHHiL T1ɺcID$ LH5W1ML$(ID$aLA\L 1ɺ]1H5 ZAVAUATUHSDOLA;L%G11+LLHEH@PHDM8LѾ1L21AELtJ1L5)L-fAM1ɺ6L1LHצ9]Lw[L]1A\L6A]:1A^Zf.HHxu8DL$j8 ZLYI1ɺ.L1,@H(1L%3_ff.UH-}SHHHGwTH@PHDL$Hxja7 1HILE{X1Z*_L ctCL fgt7L ( t+L.1H5uL 6,1L1HHCE1HHH9tHAH9u1H1-LʼL11H/LH0HL LEL11MHH1[L331]*f.UHSHHHdH%(HD$81LtHW8H5wHW7f11HH_)D$)$H\$)D$ e*Ht@L@ Mt7EP1HsuLEPHD$8dH+%(HHH1L[] HEL  HPHHCHtLHL:RT1H5Q,XZHD$8dH+%(u=HH1[]ÐHEL M HPHHCHtLHLRNHAWIH5xAVAUATUSHHHLHPH1HH5 xLH@HPH1AąHH5L1aAą&sTHtwL1HAąDAAH@`AtAH_% HdHDH5:L1AąDAALHI91L-A~uLAW AąLL1eAą|AG(fo 7fAnG(f89fA~G(AF/IFH5LHPH1Aą5AG(PAW(xH5L1Aą$M6I98A)LL 1ɺ1H5xHD[]A\A]A^A_DAL 11H5xTfLH5jx1E1)L 1ɺ1H5;xkf.GAVH5L1AąLc 1ɺ1H5wIF@dLHH1E1LH5wgfL 1ɺ1H5{w?f.Lf.1҃H5|L1AąDL 1ɺ1H5w7Lb 1ɺ1H5v1E1LZH5vy@LlH5*NAG(YL 1ɺ1H5[vf.H5mL1Aą>L 1ɺ1H5v?Lj 1ɺ1H5uLD 1ɺ1H5uL 1ɺ1H5uaff.ATIH"UHH5HOLHHEjA|$Lv!At$81HHHHU tHLHH]A\vfDL\ 1ɺiH5n(H1]A\L, 1ɺaH5qH1]A\L 1ɺeH5aAff.@AWAVAUATUHSHH5HHdH%(HD$x1Ld$8HD$0LD$(D$$0L}Ll$8IPLdHLpMLH5H@0AŅ LmLd$8I}PLPdHHpHHOAŅLH,NAŅqHH5(H+/AŅ(HUTH5Hm.AŅrLd$@L-011fLL)D$P)D$@H\$X)D$`o!HvHt$0HPH_AŅET=PL-f11LL)D$P)D$@H\$X)D$`!Hq|$(fLL- 11L)D$P)D$@H\$X)D$` HxHHD$,L5HD$H[HL{ MuLkLLHD$@D$,LW.HULL$@HzPLHT$LL$`bLL$HT$HLxML$,ALHfM^H-iqL 1ɺLHL 1ɺ1HE1Sf.AHEL * HPHHCHtLHLǿR[H5p1Y^HD$xdH+%(1HĈD[]A\A]A^A_fDHEL HPHHCHtLHLʿRaDL 1ɺg1H5[psf.HSIOHHI HtHQML.P^H5p1E1AYAZ@L\ 1ɺj1H5of.HSIMHH HtHQML&Pd{fDDžfLHT$0H+AŅoHEL b HPHHCHtLHLwRt3HEL % HPHHCHtLHLRmfHT$H5 L *L/f.HEL  HPHHCHtLHLRpf.ADHEHSHHHHe HtHQDE1PL1}H5n_AX6DLHT$(H8)AŅtHEL  HPHHCHtLHL߾RLHT$$H(AŅ|$$HEHH`IHEL  HPHIEHtLHLBRIH-Bm1HXZHEL 7 HPHHCHtLHLRyHJHIUH HtHQL}BPHEL  HPHHCHtLHLRff.fAVHAUATULSHLHdH%(HD$1HLt$@Ll$HC H$@8t0AHD$dH+%($HD[]A\A]A^HHpHHHtZ1HtSH9H<fH*HfH*^Yd,ЅYD։AIH@IEOAL 11H5Xk#Hp HHHtZ1HtSH9(HfH*HfH*^YNc,ЅD։AIH@ IE@HfHH H*Xf.HHfHH H*XHHfHH H*X;fDHfHH H*Xf2fDk'AWAVAUATUHSHH5VHHhdH%(HD$X1Ld$L!&IL}Ll$IPL4ZHLpMHH55H8%AŅmL|$ L-S11fLL)D$0)D$ H\$8)D$@H$HtPLLH%AŅ8HULl$HzPLH$YH$HH@H$HL-cf1LL1)D$0)D$ H\$8)D$@HD$HtSLLH$AŅHULl$HzPLHT$YHT$HH@HD$HnHH5H`#AŅDAL-fL1L1)D$0)D$ H\$8)D$@SIHoLLH9$AŅnLmLd$I}PLIXHt LxM/HSIMHH HtHQMLͻPDAHEL Z HPHHCHtLHLORH5g1ٹ_AXHD$XdH+%(HhD[]A\A]A^A_HEL HPHHCHtLHLzRDHSIOHH HtHQMLPH5vf1E15Y^XfDHL$H$LHe AŅLH~?AŅAHEHSHHHH HtHQLE1P1H5e蜸XZDHEL HPHHCHtLHLBRnf.HEL HPHHCHtLHLR.f.HEL M HPHHCHtLHL:Rf.HJHHSH HtHQMLƷPSfDHJHHSH HtHQMLPfDHEL HPHHCHtLHLR>f.L 1ɺ1H5;d$f.L 1ɺ1H5 d϶5DAWHAVMAUATUHSHLH(HT$L|$`Ll$hdH%(HD$1; HL$At8HIAHD$dH+%(4H(D[]A\A]A^A_MIHHH9IFrT1H@hHDHHHIH9H1HtRL9H`fH*MnfI*^Y)[,u=D‰MeDAL 11pH5bLHH}H$LjD H}HD$HD$ $L$H0D I~HXZo1LT$1H5aI1yARLU蓴HL$ L!^_HAIEDHЃfHH H*XfLLfHH H*Xzyff.@AWAVAUIATIUSH(D dH%(HD$1EMt Vt7!A$HT$dH+%(H([]A\A]A^A_L- H*Lh H-ML5q` DM}A?MmMA}tL 1ɺ1L״LHL$LL$ LD$H5SHgL5_HfD;D$r u0C;D$w&C lHH9CfHLu1LSL 17_AXfH- /U HL-L55_щ UfHH9<CtuAU1ɺLS1L ILu谱X^ THOfHLUu C THH9u?Ի@#HօtZf.1ff.fAWAVAUATUSHH-"dH%(HD$81L$XIHHt$4ILL7LMGDt$4AusTaFV1LLY IHH1LHp8 HD$HHCHPXHHPHuH9h1WcHD$D[T1DD$HHD$ATA oHEٹBh LuH5X1!AYAZLV 1ɺFf.L< 1ɺH5\1E1|HD$8dH+%(Q HHD[]A\A]A^A_fDHAI}A$jME A[[ILS$H51\1E1o2sTH$1HH(\(IHHHHHT$DHEٹ<hL tfDH$ LD\$ F7D\$ HIA}I<$&HwH@LLT$(D\$ )D\$ LT$(/AI@LHI9E1H\$ LMHl$(LEfDHkHvILW1LH5VHCI@HH)HCHHH9uH\$ Hl$(EMHD$I<$8L|$LT$(D\$ LLT$(D\$ HHIHM`1L H5U.HQXHt)LH*IH5Y1蝬d)HcLH5Y1E1Y@HHx(0LI!LD\$ HD$(LT$(D\$ HHI@MK1LH5T @L\ 1ɺH1H5TfHwIHLLT$ D\$sD\$LT$ u%L 1ɺeH5FTEI@HL$ǀIHǀ1HADŽ$A$HD$IhIpD$ExAIXI`IXAAuCTPE1 LAW4HǀDDHCH@`H3At61LfH5YWP1ɺZ1DE EPLHI99L5 WAGt!0LQzCfIGHHH9LjXH@HMHkLPL 1LIQIEZYL90IGHHH91L3M?I9$H9tML1LLΨHLHQ3AŅrA!DEOs1LLtAWAw1LB3PL 1LAźw<LH5AUP1ɺT1 L1HHǀbf.Až LA|1HDHkLPL R1LTIG^_HHH9Aw1 L 1ɺH5PL 1ɺO[DL 1ɺPH5O L\ 1ɺH5O% L+ 1ɺH5pOoL 1ɺRL 1LAźp>L 1ɺ1L肰ff.fAWAVAUATUSLH(IEHT$Lt$`dH%(HD$1H*IM8HLH]HHaEUEu8H{hHC@ct#HHtHPBfI>}LoLL4AHT$h L-H$HLHDH&HHHH9ǸHDQ;HCHH@hH9Ghs7NFH|$Ht$H(D$@h7HLHHHj L.HH)I>}LghLLAD$4LPu=ML$L1H5LADŽ$AHD$dH+%(H(D[]A\A]A^A_@HIH=I1LH5ZLTL 1ɺFH5qP13E1qHH-L1EhHLDYL ^1ɺH1{LHHLŦ17DT$H5O蛢DT$I@+L[LHHH5O1dE1@L 1ɺH59K8H0LؤLHHfD$L 11KH5'ODT$'L| 1ɺH5JgH0IHI 1LfH5J|L 1ɺ\#fD@LOHPLfDL 1ɺH5JfDL 1ɺ1H5IeHWLpLHHH*f.USHH\$ HH8 HHxHHHHǀH1H)HB HD$(HBHB(HB(HHB0HHHHBHHHH[]@H-HLz1H H11L] HH1[] Q ff.Zt@HH1H4H5{ȡtHD A~H1jLBH5 X1=Z뭐AUIATIHHUHt58HuIHL L]A\A]DLH%IL< 1ɺe1H5_ E1|f.AWAVAUATUSHHHjt$ HdH%(H$1HD$0H9,LHEP1L$0sL0L1D$,HLwAH$0H_8VHL EfvIWPIwHL֌ IHL=d 11MC LLnD[EA11LeHL$p@ljD$HHL$耠DT$HL$I1I?H<HHuD裞tS蚦8A<$HPH7PH|PML$IV L1蠜H MLL1Y yAH$dH+%(HD[]A\A]A^A_@HEPHUHH>1L IHH {HLHD$HT$LLTLLT$IHHT$1HHt$1ML 3H LH)L1'H5:nfDH5 LנIH5 19E1D؜KHT$,LL-D$,HT$01LLD$,HL0. A…c|$0xDcEu H{ tC$Ll$@f1Ht$PLLDT$D$H$0HD$`[ HD$PH:HD$X)$)$)$)$)$)$)$)$  DT$HHgL$DT$L}Ht.1HL$8HT$4LLD$
L 1ɺH5 L 1ɺr1H5 ׇ|$%H-i,!ML/1H5NXL1ɺ1H5J jIL&H5WAff.@AWAVAUATIULSIHHHT$H$H$Ht$HHL$L$HT$ DD$,HD$8dH%(H$1MD$LHD$XHD$PHDHT$LT$HD\$,Iſ EHt$`jHE1jMLjjHD$PH HDL$`EMtD$tAHD$0D$(HD$LxMMHL$ D$(MI~M~Mv Ht!HHH9LHCH\$MtHtHt$H|$H|$tIE H@@HtЅtIE H@PHtHT$PHt$LIL$MRI|$HT$`RI$LD$ _AX(t$(D$L0HL$ Ht$PH|$Xu =t_ tYtM1HtFH9ffH*H*^Y/*,ȅDDHD$ @HHHH9HHHHHH9HuL=IH- 1HE1@D )Eu<"(HT$LT$HT$LT$ 8D )fDL$(HD$ $ I|$H-/ dLKrHI11AH|$0DL$LLDL$D$,uGH$dH+%(HĨD[]A\A]A^A_HD$ 0rMDDL$~DL$tHD$81ɺHL. 1yE1bHOLIEH- 1ɺE1L HDL$DL$D1ɺiD$H- L HDL$L| 1ɺ;1H5 迁E1L* 12H5& 茁DL$H-Q L 1ɺBH`E1AH-' 1ɺ1L H4E1yfAWAVAUATIUHHSHHdH%(HD$8HoHBHBHD$HBHD$HoHD$ HBHD$(LHHJL& HHjE1E11j1jjH HHfHx`=H=doHE`HoHlTAŅLL= LkLI1HEP@AHP L4HII9`H)1L蛁HMD$H\$IA$L+LL藆HHG:aH4HKHx 1HL$HL$HH A $H1ɺMPL?n1LH~XZ|$t_D$UfL| 1ɺH5 1E1~HD$8dH+%(HHD[]A\A]A^A_fDAHGL 1ɺ1H5? _~DH1RH5NLԇ.A^_M1LP1ɺLE1~D$HHDH^LćH5NA0%~AŅLA 1ɺ1H5d }ff.@AWIAVMAUIATIUSHHHdH%(HD$811HjLE1P1AQ$ PD$@H HMH"$AMA<$EuMtAEAHA $LsIFAN IvHD$H@PHt$DHD$1IFA~$)HD$ILX`I'vAHcMIAAuHEHuHHgLxHP H;uHpLhHH9ts ELHuMtMC A)MKIF@a@HD$LHx( HD$H@ H@@Ht LЅHCHxM1ɺ PHD$Lp(L% 1L%{XZ8HUPLHr0HT$苅HT$A$L% L 1ɺ1LAzHCHD$8dH+%(HHD[]A\A]A^A_I9H9fDHu1E1E1zfDA4${HUPAEHt[BtUz0Hz0H}HH}HLn1H5JL| 1ɺk1H5 E1yI@AFL+FAF(HD$HH5fLH5'eLσHD$H5( H83HD$HtL% L 1ɺLyfDEf.HD$H@ ?H*H$PH%UCAHr(LH@HH  跠vZf.AdA`IH@L 1ɺb1H5Ϻ E1w)E1H;HSL(CAH;HSLCAH;HSLwCAHCHxH\$H1LށLK(PH;HSLCA@H;HSLg]CAL% Lr 1ɺLvL% LK 1ɺLvL{IvH;L| IvH;MLL%7CAL3 L%IHfHHLHHL@LH5Se@1nxM1H5=eLLLL^ 1ɺ+L% 1LuL%h L. 1ɺLwuLcACL%+ L 1ɺL:uLL;f)D$ L IHLfLt$ HHHMH5odLH@1QwM1H5 dL LLLA 1ɺ/L%a L' 1ɺ!LptL 1ɺ%H5' LtL 1ɺ1H5c%^L% L 1ɺ'Lsd~1|$ -t 11LID$ALcCL` 1ɺ1H5 cE1DHHAA1dH%(HD$81Hj1jjAPE1H Ht=Hu<$uHT$8dH+%(uCHHfT$11L 1ɺ$H5ϵ r1V}fDAWAVEAUATUHSHĀL$H|$ L$L$DD$L$L ~L|$dH%(HT$p1EIHEH5A 1HT$HӺUVrILL$LHjAVDL$(H A$-HL|$ xHH5WjLpHtsLh|uZ1ҹEHL}HuD$dHLLLjjD$$PDL$(LD$ HL$0.H A$uH3HHuH|$u`AHD$hdH+%(HxD[]A\A]A^A_@D$Lز 1ɺH5 1qDL$@HH}LLjjD$$PDL$(LD$ HL$0uH iD$Lq 1ɺD1ɺD$LL H5x pDL$)zff.AWIIAVEAUEATALUSHHHVHHH$HD$H$HD$H$HD$dH%(H$1HFPL$HL$HSH{LLHIHeHD$@1ҹELHH$zHtPHHD$ HLtH|$ HL$8LHHL$(3 HL$(#H|$8HDEEt$ LHHt$ t$ PH Aąt]H{HH$dH+%(=HĘD[]A\A]A^A_D Ƅ$+vDLd 1ɺU1H5 nDL< 1ɺA1H5_ E1|n^L 1ɺD1H5/ E1Ln"H<$HL$(BsHL$(H4$H|$ Hl2 tH|$8@1IL]1ɺKH5İ AmHD$f@@ 0xAUIHHATUHSHaIHti8u,HI]Me0HaCt4HL[]A\A]@HLLHH/LcHuHE1[L]A\A]DL̮ 1ɺe1H5 mff.fAVAUATIUHSurMM s 9w.LHHX8[]A\A]A^@HML:x1PH5a 1SAV|lH LHHIMt []A\A]A^fL 1ɺQ1H54.Lʭ 1ɺ 1H5  l[1]A\A]A^fL 1ɺ]H5L| 1ɺAUATULSHA@LLl$0LT$8ItALҾLAX8mHX8DELHLH[L]1A\A]=IpLHFPLNHLփL/uLǬ 1ɺH5,W k6f.I@LvH5VLHH1jH1[]A\A]L\ 1ɺ]H51L: 1ɺH5VjH1[]A\A]fAWAVAUIATIUHSH8dH%(HD$(1L|$pL\$xD$$Hz:HAHt3Et.HD$$L1HP$LPASAWH @1Lz 1ɺH5 i1HT$(dH+%(H8[]A\A]A^A_f.HD$$1HD$P$PASL\$(AWLL$(DD$$3H DD$LL$L\$T$$\I|$L\$LL$DD$DD$LL$L\$t$$L1HSLPASL\$(AWLL$(DD$$H u4D$$DD$LL$L\$AfDADsAVI@AUAATUSHH=X  H8HHAIHtIfHX@(H(Lp0Dh,H@@[[L]A\A]A^fL 1ɺ1H5 gHWDLl 1ɺ1H5 E1gf.SHGPH1HWHHHHxKHt>HSPIHHKHL 1HHHhPiZY[D1LҨ 1ɺ|H5 g1[USHxdH%(HD$huHu0ǃHT$hdH+%(Hx[]fD1ҾD4uɋDt;Hl$PH.t%1HL$HT$HLD$ H5ht51Lr1ɺH5 4fǃO|$t v‹;|$wnpff.AWIAVIAUEATE1USDHHHT$AAAGd EtUA ItAGdtPIFuADDED DEH[]DA\A]A^A_@H|$tPAfAuAIIH93}H^TfDL@tIG`H%r@uIH1AD EDEff.AUIATUHSHHO u6HGH5v\L`LnH5d\LnH;0?H6fH@(@@IU`HH%sLHLhHHH @HH(H HHH[]A\A]H0IIH9{HH0H@HHHHPHHX(H9{Hg@ [LH 1ATI1LoH5 &cXZH[]A\A]@L)p 1H5̥ bH1[]A\A]Lo DHuEH@Hto"oj'oHoB oJ0HH8HtooZ_AWAVAUIՉATUH-PSHHDO(Ht$dH%(H$1H+HDE&HGLGIIH9zIEPfH|$`L)D$`oo)D$pHDŽ$)L$@)T$PHHt$@L L 1ɺ IHIEPIWHHH;HHHtwHH{E1E1j1LjHD$(PEH IDD$EuoAH$dH+%(HĘD[]A\A]A^A_DL7Ll 1ɺ H5 1`E1f.E1E11HLHL$,T$(E1H|$DHwHK(JLAT UH- I1HLm$`HsXLZLHG|ED$L 1H 1_DL$fD$Lh 11 H5 _DL$HH5k D$4Ll PDL$81n_^E1_[iff.@AWAVIAUIATIUSHX $dH%(HD$HHB` t ,H-F$1LLL[ADžH cLLL;3H ބLLLADžWAF EEIIH9uHmH9HEHxNLLHHEHPADžuL͟ 1ɺ2 1H5 ^H LLLc[AEd=LLLLH7ADžLX 1ɺ# 1H5{ ]*fDIE`H%@H0;H4`IIH9uHHH94HCHPBft1LLt9HCLLHPtLLLLHPuLx 1ɺ| GfII9IIH9tH1LLHP-ADžIH9tH1LLADžrAD$EEN EuJEF(EuAL I>LLHHHtLL5ADž IE`fDH4sIIH9~fAt8IIH9t%HU1LL1ADž HmH9uAF tAEc4f.A~,E~(EutIIH9u_HH9tPHCHxGftAF(I>LHHCHPHLHAF(H9ufDIIHD$H9iHHt#1LL8ADžHHt1LLADžHHt1LLADžQHhHt0HC@t&E^ LLEE $ADžHHt0HC@ t&EV LLEE $xADžHHt%Av LE $LGADžDKLE1Euf;HCH@tCuLLH苶HH$E^$f)D$)D$ D$D$)D$0EtIIH9zmHH9IHL$L1ADž1L 1ɺV 1H5 T_Ld 1ɺ 1H5 T6L> 1ɺ; 1H5a TL 1ɺh 1H5; [TL 1ɺ 1H5 5TL̕ 1ɺ 1H5 TL 1ɺ 1H5ɖ SxL 1ɺ 1H5 SRLZ 1ɺ 1H5} S,L4 1ɺ 1H5W wSLLADžL 1ɺ\ 1H5 ;SLҔ 1ɺ 1H5 SL 1ɺ 1H5ϕ R~L 1ɺ 1H5 RXL` 1ɺq 1H5 R2 ]fAWAVAUATUSHH $HH|$0LE@IHt$(L$HAHL$8LH dH%(H$1蠫L`WHHHD$PL=HHD$ Hx`HHzdHT$Lru݀zmuDbA-uDKLDL$VHD$@Q[HT$1Hz HD$q^LD$DL$AjE111jjPHt$@H IHD\$PE1LYH_HH9DAH"]u.H$dH+%(HD[]A\A]A^A_f{Z8W L s1PH,KL PH5p 1PXZHW M; HD$Hƿ1L^YPHt$L 11 :P+D 1E1L]H5  P@H@PL$lLLT$HT$hLH0L$T$HD$t$L$ L]IH QT$HRG AVHD$(1OHT$`LLH RHT$@IMPLT$HLHLDIIFH3H3H IVIFH3VH3FH A>H|$(LLT$苾LT$H1ҹALLT$@L$LLD$ ZLD$LT$@HuƄ$IUPLLT$@HHT$iHT$LT$@HIHHt AFd5LLT$LHD$HH5( HT$I1L/uR] 1NY^LT$H|$8LT$HL$8Ht$(E1LH|$0*LT$L 1ɺd H5 MH|$k@H LU 1ɺA HD$Hƿ1M9LT$H1LL$ V L{[H5: ZMH|$(AXAYALpXHt$(H|$01LLT$L 1ɺb fWVHQG8S$MHIHWQH5 HDAPL S E1P1LH AWAVAUATIUHSHHHRHH?Ht$dH%(H$1ID$PHL 1ɺ HIƋE(9H}HLҦIHD='E&LMLD$HL|$PPH|$LLH HD$PHHPfHM)D$hLYH5_ Љ)D$X )D$x%D$X ЉL$p D$tP1Q1AU>KH DT$PHLDD$PEAH$dH+%(HĘD[]A\A]A^A_@HEHGHH}E1E1j1HLjL|$hAWH dD$L6 1ɺ H5[ 1yJDT$WL 1ɺ H5) 1GJE1'E1E11HLH2L$lT$hE1H|$DHwHL$PU(H}HULHT$xHLXAUI1SHT$(Hu HR IHEH LHGHG.;D$PAAD$a 5Ml$H_LARHH5n LLHt$1MLHwD$L 1ɺ \AT$|A$EDT$Ht$ H1QE1E11R1j%H ]D\$ DT$EJDT$HA$LWEL$| H5 P1;HAYAZDT$DML711 H5 HAft$l9Lt$\$hL$T$|t$L,VI1VH5 SL$ QT$ R GH E1qfH1HHH5; D$tLT PDL$x1>G^E1_@D$LȈ 1H޺ 1GDT$pQATIHUHSHI<$HH蜡Lx 1ɺ HtoIHCPLKHHLCc@tVHt"11LHt[]A\DL 1ɺ 1H5' GF[1]A\Hshf.AWIAVAUATEUHSHHLHt$LD$dH%(H$1HEL9I L5L4HD$(fH|$`DLI)D$`)D$pHD$IGPHDŽ$oo)L$@)T$PH;LHt$@i L 1ɺh HXHD$ HD$LH;HPHIGPH1L\$ L Hk MDE E1LLHL\$0HD$8HLLfD$ sHAAD$(PIGPt$(HP`E H PHT$PHt$XH|$0hH 1ɺs HL HzK(LL%+ Hv LAVI1L|'DXZHT$(HHjAH$dH+%(HĘD[]A\A]A^A_IGPMOHHHt$(HLAƅHt$H;1DHHtt1EuI 1HAƅOL 1ɺ 1H5 8C/L9I0L5 HD$(LL 1ɺ f.H5 1E1BDLl 1ɺ 1H5 Bf.L< 1ɺ?1H5 E1{L 11y L^BULZZf.AUIIѾATHoUH-rSHHHdH%(H$1zHHLAąK8u/AH$dH+%(HĨD[]A\A]ÐH=IIH:H HDHE1H29APH5sSL P1FAH tDxL-stD$L e%=1ɿ1LsL@HD J8G= LHjIH.H}]HDHL ؏APL SP1q@H 1E1L"yH5r9@k@L1Ly@BILx1L1?NJff.AWIAVIHAUIHATUSHHHhDD$ IdH%(H$X1L%1MHH-LHΘEML-1LH L袘L5b1HپHqLy`Ht$0LHt$Iu>D$H%= M1L=BqL1yL>Ht$HOIAąD$H%-`;ut$ L=pt1ɿ1L L qL+>HAtG8_H11AUL ILLp=XHZ膾 HL[>S11Ad ,fML4wH5'p1E1=H$XdH+%(HhD[]A\A]A^A_f.MLDwf.L yLw1H5o=zMLvK+tL$ L=boL 1ɺ1LxL<MLvFHXo8]C=HIHLHDHE1APL oL SP18D8(A1ɺtLPHWL PL"} 1:A[XfDH|$F~1ɿ1L ٩LYmLz:LB>D8UA1LPH)WL| PL 1(:_AXC8AL ]1La| PHz4yPL19AYAZ@fDM1LlLk19@=LHRIHHeVHDHL APL SP1Y9H H$L>uLHt$Ho>u;HD$XH9$t\L e1ɺ1LsL8L={k1ɺ1L )L*tL8qA/ C[BL=6k8?I1ɺ`PH2Lz Pff.AWAVAUIATIUHSHdH%(H$1҃tNMƃAH$dH+%(|HĸD[]A\A]A^A_fD$LLHL=kjHH-w1MHH)=vHt$H<D$(%=@yHiILhj11PH5i67H;AHifHMHH=?ft!Ht$H Hh8;=>dLHIH`L dHDH9APL SP14|$,H B11D N>f.AWAVIAUIH=gATIUSHHdH%(HD$x1= I7HD HHL 1  @ *HLHjgIt$jAuL6gH;gPHVgH=8gUP1t$8t$8t$8ML$I $*H@AąSsA@Mt2H1L1t$H=:gt$t$H Aą?{0t3HHs011t$H= gt$t$H Aą6H|$ t$t$t$555Dd$PH\$hH0EOHL-f11Ht$@L)D$P)D$@HD$X)D$`LH{H@ Hn8ML- 11Lh -LUHH1LP11L XLo$XZH Ls 11 H5@e1Ll$0H{kfDH@11t$H=et$t$9H Aą,M1L)eH5d1QDx8HH5dATILn1E1H1Ll$@Y^HDL06HD$Ll$Ht Hx蘓L6H6HD$xdH+%(HĈD[]A\A]A^A_LYm1ɺ1H5c0E fDH1H=Md1t$t$t$H AąM1LcH5cR0DM1LcH5hc!0@L-' @M1LcH5(c/@M1LWcH5b/|@H@8OyxKoxeAE1l9ff.@AWfLAVAUATUSHHH|$L9IH1HL9uHcH$:I$HT1L5fDHCH@@HtmHH9teH=HtHzI$HcL,8IEHH1LPHD$LbL1u.Al$XZHL9zH[]A\A]A^A_HD$L1bLHH51[]A\A]A^A_.HD$LLkH5L1-AL$~1I$Hf H5jg $HH-Ug D$dH L1PDL$h1U$^_*Le 1ɺ Le 1ɺ 1ɺ ALe H5f $wLe 1ɺ NY.fATIISHHBH@PHBHP LR8MtPH_1@u4HL_LgSA@$)LHLPVH7AH H[A\APL+PAP(fHHtLI fDLH(1La H5f  #1ff.AWAVIAUIATUHSHH$LD$dH%(H$BxD$XG(H?D$D譅HHH$I9F(L%hVHCHD$IHH<$,AWATI1LVH51e Q"HD$ZYH@`H2H-H|$H}H$HL$HPHH@PHӆIH HT$H4$H}|IHi A<$IEu>HxxtGAH$dH+%(HĨD[]A\A]A^A_DLLHuDKANHEF HT$H4$sH<$AVE1DLHGPDT$H@`% H HT$AD\$ɔH|$D\$DT$A E11HLLLARSASԓHD$@H HHL$ AHHEAHCH$EH@`H2sE(H4H4$LLM9uvM$$M9t^ID$HPBftE1ILLH$t$ID$ILLAHHPuLa 1ɺH$H@`H-VH$D$lH|$.H$LHHD$8L9Ht$HqHxSD$HHDHEHT$0HD$(DI|$LMMDI_HC H@H LLI|$HD$HL`t$0 H5b t$@P1LL$8HC H H@XHtIWLHJP1H9Ѕ@ M$MLױH]LHHyHH88xLHD$H#Ht$HHHD$qHD$HaL+L_`< IH56a 1TEED H}1LLsH* E1LLLH IIH9ttLd$IHID$HxH}LHID$HP Ht0ID$Hx跰LLHIID$HP8 M$$L9uLd$L/L_R IH5:` 1XI$HtE1LLH*" I$HtE1LLHb I$HQEVEI$huA|$LE1f.ID$H@tbu[I$HtNHTHtDI$HHDH@`HttE1LLHN fDAE;|$LQDH@I$HH؃8bHxHHW`Ht BM(tID$H@ 2E1@HLLHL]] 1ɺ 1H5^ L<] 1ɺ[DH$H}1L趭HH$H@`H-*H $HH9HHH93HE1LLHHPADž H$HH9u3HE1LLHADžLi\ 1ɺ1H5] L=QM H$LM1L觬IH; IGH@7 H4$H}H v ! IՖIIɖHLYATI#H5\ 1AYAZH$H}1HPHH@PH~IHvH$@d #H<$H<$莬HD$H$Ht @dgH|$|H $HA`H%|HHH92HWH$HLHLIHADžH$Ht$ HHADžLzZ 1ɺ1H5[ H $HLL9j1HH$H4$HHH9!1HHTHfDLY 1ɺJH5[ 1E1V II$H|fDu(I|$苔 L2ZIH5Z 1ID$IT$H@P1BtAD$L+BAD$(AT$$H|$ )HPH,AD$8AD$Lt$M$$9CƉD$L;d$8H|$H$H@`H%Hs&H$Ht$ HH^ADž'HC`HH0 u6H$H5LxHL@u_LHsD$X1ۃpHL$ U,tFH$@a tLU 1ɺ 1H5V xH$DH|H|$L:LHLHADž H$HHV LcXH}H= L8 IHLcpH}H9L7 HH HCXH@PC$HAFIuH<$HL$NHL$7DKTH|$ E1LL " H$H@`HfLT 1ɺ H5U LH<$E1萏HH5U t$I1L[Q ^_LFT 1ɺ H5fU L"T 1ɺC H5BU g$1ɺxE1LS H5U @z1LS ?H5 LS 11 H5T ULS 1ɺ H5T 1@H $DEH $LHHt$8L9D$HH$H@`H©@pH$Ht$ HHXADžJLR 1ɺ1H5 T ,fAv4IG@IWH}1L4H IWBHIyH<$ImHL QAWIA1H5pS XZAFLR 1ɺe1H5@S `LQ 1ɺ H5S <D$D$X{H<$Ht$XtD$XdH $HHH9k(HAfumH|$!HHHH9S(HH}1LHrH4$HF`H0HHH9(HAfHlLP 1ɺ H5R >LP 1ɺ1H5Q RAH4$1D$\D$HEHHD$(iHD$ HHt$`jE1E1j1ҿ jjHL$@Ht$PHD$0H HHt$0 D$`D$lHt$0tXH|$jE1E1j1ҿ jjHL$@Ht$P脂HD$0H HN D$` D$lHD$HPH^HzHT$0HLH5BzHT$03HzH1HT$\H5P =L$\Hqr9L$H/H<$HDЉL$8HT$0Ht$D\$lL ALYLVHT$8EH5BP RL$HQPH(vLD1I H H|$kHt$ H|$( D$;D$\IGH@EF$EA|$H<$蚉.LLIH5O 1 AFH$LLHL, ADžAF7H$@c)HHHPpLLHLv2?ADžH$H@cHH4$H}H 0 IHLcpH}H2L_0 HHbHspH}1HL$fHL$HIH$DKTLH|$ Hph H$LHI9t*IT$E1LLH`ADžM$$I9uH$H@`H4$H}Hʴ / IHH$H|$ HPhIHHD$ A?H8H_RLnzHH>M 1LKH5 |LVL 1ɺ 1H5yM  L5L 1ɺTH|$HH}1L襜HH$HP`^LK 1ɺ1H5M . hIWp1ɺALK H5L 8H<$蠆(L/IILsK 1ɺ1H5L  D$pI\$PH|$ HwHD$ Dx@hEu ǀǃIH<$IHL/IAWI<LJ 1ɺ1H5K  ALJ 1ɺ1H5K LxJ 1ɺ1H5K H<$譛HH$HH9.!L<$L|HXIW`yLJ 1ɺ 1H5N HzH$H}1LHnIHlLHLH聵ADžPLI 1ɺ1H5J L|I 1ɺ1H5J uLVI 1ɺ1H5yJ OH$Ht$ HHТADž[HS`{HLpH IH5J 1=LH 1ɺH$Ht$ HiADžrLH 1ɺ1H5I 'LH 1ɺ1H5I }L^H 1ɺH5~I IGH@L2H 1ɺ H5w vxH<$L$ IH5ܯ 1ALG 11 H5I  H$HH9fLG 1ɺ 1H5H L肂L IH5F 1LGG 11 H5jH HL-L9 IH5 1VLF 11 H5H 5LF 1ɺ1H5G H|$ L؍H11LF ?H5ӭ vLiF 11 H5G jLCF 1ɺH5cG HH<$*L.E IH55G 1SLE 1ɺLE 1ɺ1H5F YLE 1ɺ1H5F 3LE 1ɺH5F ;LgE 1ɺ H5F TLCE 1ɺ 1H5fF .L)L7 IH5 1TLD 11 H5F 3H<$L IH5 1LD 11 H5E f.AUATIUHSH8dH%(HD$(1nHnHU8HE1E1HZLkH߉H L |Ht~Ao$HL$LVM-Ao$D$L$ AąH{H{ٰH;dHD$(dH+%(H8D[]A\A]HE8 % HMHtsH9tnLIRLRDMPH5fD 1A~XZ\L C 1ɺ[1H5/D AI)@L rLC1FH5C Al ff.AWI׺AVAAUEATUHH5JSHLHLL$dH%(H$1AElLHEH|$01ҹHH|$( H81HL$ HT$(1LD$ d Lt$ MLZAHD$EA8H 3H|$(HH3HH9LNPLB1QH5B AVWH ZEtL H53L H53LtoH53LtWAH$dH+%(HD[]A\A]A^A_DEtHD$HtfA?CHL3HL3HEHHHH9LJHLBE1UH5yA P1AWH ?HtHHt H9L 3pU1LDAAWH5'A LXZDL ol@EfƄ$L? 1ɺ1H5@ fLHtL o@8H 1H5wbHD!AWAVIAUIATIULSH8|$L$p=0L$L$H|LIqLHfH<$HD$XHHD$KHL$HD$ IDEHD$H|$HL$t$ VtT$fH|$ H|$aIHT$HX@D$LAWAGLHHPHT$ I_HT$LHLHLpL I_ LLLHLhLn L4$I_(LL[LHL`LI I_0HL:HHHP+ T$H`I_8H=HIHIGL8L=H8[]A\A]A^A_D$L$L|$D$pH8[]A\A]A^A_*f.ڌ ܌L='H HD$II9unfDHIH;\$WHIw(LuIw LuAGH iIL,IGHBHH H HH-k-Lb>1HH11LN< H81[]A\A]A^A_|$D$1tH HHD$L;H9uT@ILL;|$?IHs(HuHs LűCH RHH߃,HCHBHfD+1H|HuHD$HH9uHHH;T$Hƒ{uHs(LHT$(HT$(uHs LHT$(uHHCH߃-HBHJU谪AUL-ATUH-+SHHdH%(HD$1=GHt$D$u &L-uH-iH]L9t`L%fEHLM8LE0HM(HU Hu}P EHUHA,HEHHBHZXHZL9uHD$dH+%(u0H[]A\A]L9 1ɺ1H 0qVtÐff.AWIAVAUIATAUHHSHxdH%(HD$h1ZtHQ\IAEH5a: APL+,H,HDDHRPHUL к1VXZAGe tII9Y1AE AD$E$'-Eu>cHHHˍHADLHH脗dHCAE1҅H}LbQL>8 1ɺIHHCHD$At7A7AAHCMǀH|$$L@AŅAHCH{[֤H{ͤH;uXHD$hdH+%( HxD[]A\A]A^A_IG`H$H%DDDL蘈HD!WEH|$1ɺ$L謒AŅH}AB+$Lk`E1L%YDMM6M9MIFHDHLH}HL$XHT$PLD$`EHEpXVHT$P:tHD$`8uHEHMMHhPHL$h_AXMdLs`M9`4$KLqL81ɺIH5&7 1DD=UE*Em1ELDHC`E1H$MMmL;,$M}IEHpD`LxE2L%XMH}HL$XHT$PLLD$`WHD$`8tMtLL sLLxHELHGTVH+LLH]IHELHGHGL4 1ɺwH55 L4 1ɺH55 1E1LE1oLy6IH55 1fML`MMzLk`L;,$zHEHGH9G6DE&HCHELGHGLI9Lt$L-&"f.HEM$$HGI9`ML$1MH54 M|$L1LLHuL>3 1ɺH5^4 ufDAAEL LDLLHH2AŅH|$L AŅH`0I#W`uAH|$L AŅH}辉8HC`D$E1H$MM$$L9$$MID$HLhxMtDXLPEMt'MuMtA>tLLLT$5MuLot"H IF`HH%\A}uIMHL TMHQPHIHHHHhPY^D$MLc`L9$$T$hL5lLv41ɺIL1 1ɺ 1H5'2 GH{H{H;QL0 1ɺ1H51 E1 @LkL2 IH51 1E1jIG`H%r @TL蟁IDǀF$D@L 0 1ɺ1H5/1 O+L/ 1ɺ1H5 1 )L/ 1ɺ1H50 HCǀHCǀXML1eH50 IIL9vHI}L/ 1ɺ1H520 R.LQE<DLI21rH5/  H}HL$@HT$8LLD$HPLT$H}LHL$XHT$PLD$`LT$PLT$MѹL[1 H5m/ HGHGHGHGHHff.UH dH%(HD$ tHD$dH+%(H ]ÐHyHB H5? HAHHHD; fo$HD$D $H.)Ex  tXH-^11DL/HHD$dH+%(uWH HL/1ɺE1]fL/1AH5AUATUH~lLIMIHVHIE H taEUHMRAQL .H5hEL/LD1A[LXLH5CH]A\A]t@@tNH$JH1RH5<L/XLZH5zLL01DH5l]1A\A]@H1RL8/2H5y7_LAXLHH5]A\A]隳f.L).1H53{L1.1$H5KL9.1)H5L/1AH5\H1RH5u7LL.'YL^LH5AWAVAUATUSHdH%(H$1HHwL%1LHIL.LHӺUH=LuEm D$<H|$@H5eHD$4AXHAY0H1Lt$HH=1t$Ht$H轭H Le.AǺ5EHtCH1H1t$HH=t$Ht$HlH L.AǺH|$Pt$@t$@t$@555蔤$L$H0IEf11)$HH$HD$pHHD$)D$p)$@H~H@ Hq8H57 1ɺ-1Ht$L .L VHt$H11ɿHIL PL!1VXZIEHt$f11H)$)D$pH$)$;@HH@ H8H5{ 1ɺ-1Ht$L rLD >VHt$@HD11t$HH=t$Ht$H荫H ADžL/,DL11AD$D$aDAE1HLUILQ 11LD$pY^D$D$MaLdHD$@Ll$8Ht HxELDT$$D$D3D|$( D$l$x Љl$XD$$HD$$HD$pHD$PEPdL1L+=tuLL,11y AH$dH+%(HĸD[]A\A]A^A_fDHxH5+ADžXD$E1D$LD$`I}LD$}DLD$LI,1ɺd1LA^H5ό @HxH5H fAYIEH-11Ht$H)$)D$pH$)$=H'H@ H8[H5H I11Ht$-L SHt$H1ɺ1HEL PL1RA[]IEHt$f11H)$)D$pH$)$O<HtH@ Ht 8H1H5 1jLL L SRY^D$AD$,@L'E1QH5ZfDL! 1ɺ[1LE1ydeoL1Lp) fEL.(L1_E1z DH5 H1ɺ1H DL mzPL31;QA_XIEHt$f11HBz)$)D$pH$)$:HH@ H8H5 1ɺ-1Ht$L yL PHt$H11ɿHMCL yPLv1~PXZLE1A[ L 11LND$D$/H5G H57 HxH5)ADžuML[&1L溳11HxH5NfIEHt$11H)$)D$pH$)$:9HtH@ Ht DEHL 11jLE1L H5Z >OAXAYrL1L&paL1L%KgL1L*&#lL1L2&hBDx9DAVAUATIUHSH@H$L$L$t@)$)$)$)$)$)$)$ )$0dH%(H$1fH)D$ )D$0貞H$pH|$@D$@HD$HH$HD$L0HD$Xt$t$t$.H Ht HcuH|$ t$t$t$5 5 5 Q\$PH0HD$Hl$Ht Hx=H9\$ foT$0foL$ AT$A $H$dH+%(%H@L[]A\A]A^@H1H=1t$t$t$PH E1Ll$`L5 F!f.H9] ALL1  HELH4HIDH11t$t$t$šH uLbH5L:1H5ФMff.fAWAVIAUATUHSHHLdH%(HD$x1 H 1H|$ jLc1H5UL QH ATLl$XH 1ɋ|$ HT$Lkv ;D$(ALL#1"H5 DEuCHl$0MHHD$xdH+%(HĈD[]A\A]A^A_@IEL=Z11fHt$@L)D$P)D$@HD$X)D$`<4Ht7H@ Ht.8MLk 11-H5q PJL:L#H5 1E1"Hl$0I}:D$AAA)|LCH3LPLJ 1H5XZ=,%=-}=(K=*uH(LUL?"DL@MLLD$NI~LxL:HHt$HL%HHH菸tH蓨LIL"fDH,LUL!fDLL!10H5YuhLL!1%H5)E8L@L"ff.AWAVAUATUSHH $HLpdH%(H$1wt1M<H1ҾH´AEujAH$dH+%(HD[]A\A]A^A_MLl!H519E1@IUHH1H}Muh9IH L$I1H aHHb-Lb.z1L1ADžHT$1rpDPhHD$I L9szH1H5WMPL 1aHpA[A_AH5$Au3HpL LHH1fDLtH H|$ jAVLcL H 1QH5 H D 1AWPLt$XH 1ɋ|$ HT$Lp ANjD$Eu`KHl$0Mt I~ 6H1E1L H55Q@AAAEfL 1ɺ1H5rf.L 1ɺ1H5ÝFf.MLk1MH-tLHD.=L 1ɺ1HY1H|$@HpHDD$@HLJhHT$LD$THH5 M˿HF<I 1D Q1AWASL\$(DH$HH$H H4$HT$@BL\$APH<$L\$}L\$AH$1ɺ^LH59H@hIHD$1I AQE)ASL\$D-GxEtjD-ˊEt^HD$xdH+%(HfDAy.1E1LH57HD$xdH+%(^HĈD[]A\A]A^A_uD-wEtD- EtHD$xdH+%(H$HĈHL[]A\A]A^A_@D-IwEhD-ɉEXHHHD$H9E1L|$Lt$ D|$DDHH;\$t-HCLLHx@t߁|$uA@Et{L5ޗE11LL1Ҿ'LAAELL1E1jf.L5c1ɺ1AL{Lf1Ҿ'LwA@=4$E1Hre AŅHpHLhHH _7H|$ jQH XLc1QH UL D1AWL= H5IQH CAUQH ?AWQH #S2H$1HP|$ HT$Hh AŅhD$(L1LLYfEHL f11Ht$@L)D$P)D$@HD$X)D$`&Ht;H@ Ht28L *L 1ɺ-1H5u <L1LLOD@BHpLH @HG# Ht HuL 1ɺ&1LBHl$0E1HH)@D$AAA.}T=*J=+=,L1LLFg$OL1LL)o=$uYLLHLP1AQ2_AXL1L =(HLPL1LgY^|L@MLLD$I|$HPHH$+HH$Ht$HH$HpSHpH $HHh`7LHܩHܙHl$0H{*1ҾLDL$,DL$AAAAAAAL=$ޅEofL1LKLAAL{=vHpHLLpHL1 XZAA=6LX*L1LL&_L1LL3L1LL\L1LL0AAL=OR L1LL/EL )fAWL=AVL5NdAUATIUHSHHHt$H9LkLDtsL8ztgLkIEPHHtS[tJ1LLL7otcHsHFPH4$HHt&tH4$1LLot}HH9qAHD[]A\A]A^A_f$HCHLpHHD$L1H5fXZD$f.$HCHLpHHD$LAVAAUIATUHSH@HdH%(HD$81@AHtgHpHBLHg HA HD$8dH+%(=H@D[]A\A]A^DAč@w AA-H"!DHcH>DH=1r+LLL 1H5)EHD$fL 1ɺ1LfD1L' 1ɺLAH$HxmDHL L1L 耸HL% )fD @L) 1ɺ1LA HpHL LpHL1˷AXAY}-ff.fAWfAVAUATUHSHLD$L $dH%(H$1)$)$)$)$@kL$IIHϺ@L 'Aą*tQIH5ToNAH$dH+%( HD[]A\A]A^A_@D%i`EtD%rEtH$H8sxhD`E}$PoLLITHH@IHeHHH9HWHB H5HH)IAV` L SH5Ӏ1AXAY@L! E12 H5軵fDHmH5HtH5H HL$LL$lLLLD$pLD$pD$l ODT$lEAL 1ɺF 1H5fHSH$H$PHD$Hƒ0 tUL  )HzL@LD…H HDL$1HxL Ld$HD$D$$Ll$HHl$PLHEHD$lHD$8HD$hH\$(HD$0t$(LG 11t$ s H5t$UMMH H5_lL{D$@HLQHLhfHD$pHD$H)D$pMdHLQHWH@HJMIL93Hl$XE1LIDHuLtDHmAH9uHl$XEIcHUHD$pHuML9Dt$@Hl$@DIt$L DID$H@@HtuHH9tmH=$HtHzHT$pIcH,茼HEIHt$@1L_ 1AeH5d}A|D$]XfM$$I9[Hl$@MIIILt$8H=Gt$8t$Xt$(t$ t$0LL$H H03D\$x1E~fHD$pH{LX^_YIP LAVMf1H5{E1XZH$I;uu{nu {vYH5=HI?H5MH2(DI=&H°H LHEº PAVM)fHL1UML\H5y AXAYLHt$HMHD$pfHD$H)D$pI=.H ULMH ULMfH ULMDH ULM"H ULMIHl$PD$l t$PH AVLMLJ(L DT$xAI1E~!fHD$pHeuB~xu{>{변{"1LLDL$DL$'L1ɺ71L藢lfIL1L1p>Av_D$$t'L1ɺ71LDL$6DL$ELFL1E1I8Irs{h{A-iAwKA&HLL LLE11臡{111ҋD$$ǃ"<V@oLP1ɺ)1L"DAA wHJcH>L|LEfLPL:L$LL2IL91ɺ 1LCL1ɺ1L!L1ɺ1LqL1ɺ1LݟOL1ɺ$1L軟-!H @HM @HI1LK "H5L U1Hff.AUATUHoxSHH_xH9t:L- L%LK(M1ɺiL1HH9uH[]A\A]ff.HH5t<Hff.@HH5 Hff.@H?H6H H ٨fAUf1ATIHUHSHHHdH%(HD$81I)D$LH|$1)$)D$ Hu/A$AHD$8dH+%(umHHD[]A\A]fDLHH2AŅt$tA$AIٹ"1Lj H5J yfHD1rff.AVf1AUL-ATLUHSH1H@dH%(HD$81I)D$Ht$L)$)D$ Ht^f11LL)D$)$Hl$)D$ Ht3H@ Ht*8t|MLV 11-H5G L P"L_H5I 1E1iHD$8dH+%( H@D[]A\A]A^DLpA>tHCLHxP:HLhML5LHLkAąt4 $A@L1HAątgHCAHH` WM"1LH5I 虛+@MWLL 1ɺ_1H5H O赥DATUSHG@HHHH5HH@HPH1Aąt5HH5HP1Aąt{AD[]A\D1Lb 1ɺnH5H 觚D[]A\1E1jLH5G qD[]A\fL 1ɺo1H5G ?ef.AVIAUATIUSILHl$0Hx-LHHHpHHSIHt$8HAHBPLJHDLD,AąteHHFHHH9wHCHH@PF1Hȋ`LH'AątBA[]DA\A]A^1L 1ɺH5F [D]A\A]A^1L 1ɺH5ZF [D]A\A]A^1E1Lw 1ɺH5'F 輘[D]A\A]A^AVL5NuAUL- ATL%E UHSHGdH@PHHH`DL$H{jHƃ1LILX1ZHH{DL$j`YL^I11L躗L<L怽XL IEHL1P1胗YLLME11L <L,$PZ_AX HDL$H{$j1LIL?X1ZHH{(DL$j4H YL^I11L臖D,11LLc[LH HrL HDH1ɺ<LNP1!H{0DL$$4H _1AXILq1L溴迕HH{4DL$j4H aAZ1A[IL&1L溷]D<11LL9D@11LLDD11LLDH11LL͔1DL1LL詔DP11LL腔DT11LLaD811LL=\uK[]A\A]A^f.HL P1LAVL,<1A]A^DL 'tCL 't7L zt+AL11[H5 蠓L d [L]1A\LA]1A^t@AWf1AVAUATL%SULHSH1HHdH%(HD$81I)D$Ht$L)$)D$ Ht^f11LL)D$)$Hl$)D$ Ht3H@ Ht*8tzMLL 11-H5= L "L}H5? 1E1臒HD$8dH+%(HHD[]A\A]A^A_ÐL`A<$tHCLHxP%0H|LxMoL5H`HLAąL5HdHLbfAL$$HHXIF0H5 AF8AFAF UAąHYH5 H4Aą9HZH5 HAąLL5) HLAąHL5 $ H(HLAąL5H,HLdAąH[H5 HAąL5 H0HLAąL5E H8HLAąL5 H4HLAąlL%l H<HLnL%[ H@HLML%J HDHLq,L%: HHHLP L%) HLHL/L% HPHLL% HTHL1 LHL% 1Hl$LHSǃ\1L1HIDAąwHCLAHH`@Gsf.M"1LH54< Ɏ=@ML( L< 1ɺ1H5; f.L 1ɺ1H5; Of.L 1ɺ1H5; L 1ɺ1H5d; mLHY< HHtH\5LHD$8dH+%(uHHL[]A\A]A^A_'L> 1ɺ&1H5: 聍ff.ATUHH57 SHHHH@HPH1R`HH1H谆AąEHCdHHH@PH1zAąwHU AąXQYZtH5H1誉Aą$H5H1 腉Aą2(HH14 H ܅Aą,H5yH1:Aą[*H5jH1AąL 1ɺH1H5@9 Ջ$Ll 1ɺ31H59 诋D[]A\AL9 11ɺ2H58 |D[]A\@H5;H1oAąL 1ɺ;1H58 3낐H5H1/Aą`L 1ɺ=1H5^8 ?fD0HOH14 H ZAą8H5@H1踇Aą}4H/H14 H Aąz<H5H1mAą~@H5H1KAąDH5H1)AąHH5H1AąLH5H1AąPH5H1ÆAąTH5H1衆Aą'D\EA1L 1ɺ5H56 GD[]A\L 1ɺA1H56 cfL 1ɺ81H5Z6 ;f.L| 1ɺJ1H5*6 迈 f.LL 1ɺC1H55 菈f.L 1ɺ?1H55 _f.L 1ɺE1H55 /{f.L 1ɺM1H5j5 KL 1ɺP1H5D5 ه%Lp 1ɺR1H55 資LJ 1ɺS1H54 荇L$ 1ɺT1H54 gL 1ɺU1H54 AL 1ɺV1H54 gL 1ɺW1H5`4 AHAtBHAt5HmAt([L}11H5 訆Hl H5H1蠃AąL! 1ɺ[1H53 dL 1ɺX1H53 >fAWAVAUATIUHSLHdH%(H$1I@D$8L$HP HJXHtHT$81LHC@D5L{EIWP=VfHD$P)D$@LLT$,L\$@IGhE11L\$11L)HD$@dH‹`HH9(9r)D$P09r)ȉD$THt$LFH{HHHCHPHH@PHIH!HHxHHHHpsLO 1ɺHHD$HLH@H@hHD$D$8HCEH@PAAdH苃`HH LL$HIA9I}HHH$Hr-L 1ɺH5, Lv 1ɺH5&1 1E1趃+@1E1LH50 艃H$dH+%("HĨD[]A\A]A^A_DLPHE1E1jH1LjHD$xHD$0PH|$(H t$`IW`IGPH HH8H[fHHD$L)D$@D$<HD$PLHHD$H8hLD @HHjE1E11j jjHt$8H HL$`HKHD$H8HCL\$@LD$@H|$Ht$PHPPL$TL\$H@hL9DLLL${I$HLL$L6H5* DLT 1ɺ1H5/ 藁 fL, 1ɺ1H5t* nfI$LPPo$E$A$o4A$oDA$HTI$\M$AA$HD$I$ABADž2H)HD$HjLHD$KLHIH5V 1tLT$IBH;HHHx HPHL$ HHHL$yHHH5 LT$(HT$蟊HT$LT$(HD$@H|$HT$ H5( 1h{AYAZ_H HL` ML= L-( Mw Il$}u=Md$MtkA<$tL - 1ɺ1L|LzfDLH}u LH}u f.@,҉t H 1ɺPH H5' PL 1L6zY^B@,8<&H1ɺH[ L PL$= 1H5L' yD$ A[A\.fH L 1ɺPH L 7 PH5' 1y_AX?,@HL  LL$ H5& Q1RP1MyH h|$f =?,$@1E1L H5 x|$7|$&>ff.AUL-C ATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLH]Aąu1LH5% /xHD[]A\A]ÐHGIHWHHp0HBPH8^ff.HGHWA Hp0HBPH8ib fHGHWA 1Hp0HBPH8 HS@Hf L8Ix@HT$hLH LD$hHS@L$HfHHL HH @G@ LH5AqH$HD$hHtH9t H;8tHzjHD$hHlH98HxFfA @fH5z H{LfL%HL$(LzL$(fLHLzLH$zLHL~zfA($f.Lwf.H5_HHT$8zHT$8H5HzHT$8L8LD$hfI1LH5A3ofDfA EtI@HhfAhH= RI@H HHD8@HD$nfH5ؘHHT$HHT$@LD$8"y`DŽ$ HD$`Ht HH$HH E1H$1E1H\$8L-`tLAIfDAEEIPE`u0$tAtHLLH2Ht MHLDA(u$H\$8L})Hl$hH$H|$HD$pHD$xHEH$H|$H5IqzHD$pH LL$L%d 11LLZm$D$H} HL$Lt$(H\$ALl$0HHHD$7f.1MH j HH9\$HEHf11L)$)$H$)$LHHuL LL1E1nl@H5HHT$HHT$@LD$8vLD$8HL$@HT$Htf'fDŽ$ 3fXf(xf111fH|$ 1HPHHHHPHt:uHPHIHQH8H@f.H|$ H8HuLqyLD$8HL$@HT$HH5[HHT$HHL$@LD$8uLD$8HL$@HT$HLHHT$HHL$@LD$8\uLD$8HL$@HT$HH5HHHT$HHL$@LD$8'uLD$8HL$@HT$H H5I HHT$HHL$@LD$8tLD$8HL$@HT$HCDŽ$H(Xxf$ft$ ft$ft$@ft$ft$ft$ft$$ !HT$`Ht HH$Hl$hHD$ LB1H5=iLQ1H5igLL$LE1L;hDHl$pH\$HH.H;(tuHmHAtEtXuTHrL. 1ɺ1LuhL 1ɺUH51ANh6A uE(fLK@MtfAxMPL1H5pAg:ffO,fLQL{1ɺ1H5Ag{HHHD$pHHHD$HL$pgH=PSt HL$pH=83t$LD$(H e111ADžHl$pAHH[H;()L1H5<f LE1H5Afrf'Z]LHT$`LH$DŽ$LHK@HT$`LH$DŽ$uL 1ɺLL$L1L(eHl$pHLH*H;(7IH H$H}H0I$H<H$1LH%yI|$tHL1H5epH5HHT$HHL$@LD$8zoLD$8HL$@HT$HH5 HHT$@HL$8JoHL$8HT$@H5HHL$8$oHL$8DŽ$7HT$`LH$DŽ$w+L 1ɺ E13L 1ɺH5AdHT$`LH$DŽ$ L 1ɺxLH5 [ cH}4I|$*HD$hL= 1ɺQ'L1H5Z jcH}L1}H5Z ;c돹LH5gZ cUH5HHL$8~mHL$8u3DŽ$Ht fh$rH5HHL$8.mu{DŽ$HL$8Em;l8iLL$H0H +)IH H5Y A9HDRAPL QP18bH +1LH5 bG7ATHUHSuAHE`H&r Hy@AD[]A\ftHDL%IH51maff.AUAATUHSHHHF`HO@H4E!Hf!ujHbAątAHD[]A\A]xHHH9y@3u uEE1!ttf/tF=LsH511k`T61H=b7tNctE1@u>HPXHJ`t.HHHH$HfLhXA$I\$@Htf/L:HI/HLH=H1.fD1D1VfDHH5ۤH|$CAEtH|$H5CHfDTu GatfD1GfDGgAWAVAAUATUHSH(H|$H\$HdH%(H$1Ht$HxJHD$fHDAHAVH1ҹAUATUSHdH%(H$1ILEIHuD$:LFHt,LFHtD5+E~EL%+1LHD9t$H}L(HuHcHIDfD1H$dH+%(uHĐ[]A\A]A^GfDAVEAUIATIUH,SHH8FHtH5HGAEu\A fJHf DHH.D[]H@Hf|&A$A\A]A^DHH-=DMtEu fHH H@H(H99uAEcf.EtcfJHfX)L H5i1;fK[]A\A]A^fD L'f7wVf HL.ff.fAUfATIUSHH8dH%(HD$(1:-)$)D$I,H׉4DHtHLHLuN fo $foT$HHHDHP HD$(dH+%(H8[]A\A]u4 fo$fod$HHHX` fo,$fot$HHHPhp rILfCH5;:fKCDff.AWAVAUATUSH(dH%(HD$1D$>IIAH1@fDA9OAyOAy_LLLzA9u$HE8OuxOux:uALcD$IN|MA9-uAy-tb1LH5LT$)9MLT$A9OIL$t1LLLPf.LHL$HT$E1Lxt$CtT$A9HD$dH+%(ueH([]A\A]A^A_ÐHAH…t JDH HLPH5ʜ1RAQAG8fAMH BfDAWIHAVIAUATUSHHdH%(H$1HHAHHH$HǻI&fHxI|HH A@HuLDLL`H$dH+%(HH[]A\A]A^A_P<1IٹL H5)7AFfAFH$dH+%(u.H[]A\A]A^A_ATAFFAfDAWAVAUATUSHHdH%(HD$81HD$IIHcHD$E1fDHT$fLL)D$)D$ AfoL$foT$ AfAAHHID 0fAII9tPMtjO4LNnAH5L\@u`HcIHA8I9uHD$8dH+%(uiHH[]A\A]A^A_I$8OuxPx:ktfDM1LʳH5̙Q5fAM.?AWHc3E1H 9AVHAUATL%'*USHD$HH)fA<$IcHD$1E1HL5HMHH=*L AIHA"fA9uIcHdfA$Hi3t AƄ$fAt AƄ$EfEt AƄ$fAt AƄ$AAtbH)IL+HH(BƄL9uE1L*LHL9tuf;uft-L:H4IMHf.D9tH(L9uIIuAHD$(IA;[]A\A]A^A_CƄ!IIYAWIAVE1AUE1ATAUSHH|$3HD$DH8 AthAAtDA2tnAAHDHI#tA0trA1Et|A5AGADAGuqAA2uDAGH[]A\A]A^A_fDIWH5Ε 14P@AWH5 1p4/H5N 1U4wH5jN 1=4KHH51[]A\A]A^A_4AWAAVAUATUSHH8oT$(Wt$HH H'/HH D HL$fD$.EtH{Ht H1H5 3ff 4D$Ls E1H-7L-=1@1LI3I>u^ AI(D9E~AIcH@HT#HLu1HʿH5W 2I>t 3LDH=f Ls E1H-<7L= 51H5v2I>uND AI(E9IcFIH@HT#HLu1HL?2I>t o2LDHHD$@DD$D$D$@=9+)H5Ɠ1 1f+t] 1ftIH E1DAH(D9~$H}t 1H1H@t$f HH511HHH H510L$cf <L$.L E1H-S5Lt$ MI͉L$IIJHD$HDIDA$ I(9HIcOHIIHDt#EtSft(HPH4HP(H@D;(tH(H9uHs*HD$fxvyH5U1HL$/HL$AH5HIHHL1/I?H51/fDLH5ԑ1/ftC1H5ʑE1j/fH DH51=/ s/T$(uH{Ht] H8 []A\A]A^A_E/D 6/H1HYAH(D9~H}tE1ffIcH-83AHHl$L| LmH5h1u.H|$KdAH5@HHL1L.E1H}ubD AH(B6D9~rLceHL$KdMHDt#EtErH5ޏ1-mf DT$ .HDH3DT$ wfHl$A9KD$L| Mb@H5h1u-KH5΄ HHT1U-I}unE1 AI(D9:Mc}KMH|#uAt[EzH51,uf. -DLH8E1ufHD$@DD$D$D$H51q,H; H51L,`D$f.Lt$ LfLcd$E1MIMJIDMHD$DA I(99McwKvMH|#uft%HH4HP(HD; tH(H9uH*HD$fxv B0uH51a+KvH5 HHT1A+I?u;H51(+3 V+LDLxE 6+LDLXH5،1*ff.ATUHSH蝤HHPL%;1ɿRL1IL 'H}PY^9 tH}P@6  IG@AHAf+3+cA}xAmxLѠH1PA1L H5h#L$$D$XZ~"u.LLA;D$fgv1"AYAZt$2H-1LJd 1ɺH"11ALLAC+ LLd1ɺIIEPIAHIH9øHDHB@H ft S@f  CD 9C@ ==L_H5 11!C@CDN fDIEXAHHtHXIEPH8Ho@H f 1H-tIEXLULI1SI~H51+!L$$D$AYAZ 1Ҿ*LAEIE`HH39AHH3H3HEƒL$D$IE`IEPA1HH@@HtfXt<IIH9¸HDIE`  @.Y9YIEPA1HH@@Htf8tIIH9¸HDIE`  @X9XIEP1ҾAH8IM`ƒtO DHH@HuHHG HIU`L#H1SILţH51JL$$_AX1ҾLAjIW@HtftA9EtAEtS1ۃLhH1ɺSILrH51A[L[4L1ɺIH5ҁ1`L$D$YI}PGQADA'WtAAmHD$xMAID$pAEcx L9=7IGH@ L|$@HL$lHT$hHHt$pLL$xL$IGt$l@ tI@ft t(HD$;Lt AEf9LovH$HT$xHL;yAHD$xHHxsfDAfA8)$L)$)$)$AEdL LADžoH$H$IIHD$(H95DPLE HD$($HAAA$AAA HJD$$D$$ D$ $D$0ABH@Ht DHHHH95HPB thEtT$AEtT$AEtT$  A @yT$0AHH9gEHE@Hf/EHD$(AJH IHHPHt HA@ tGHH9qHHHH9u 4AO vIL LIH5}1gE1tFL$t>L=I11L_H5}"D$DLL[ 1ɺH5S}fDA-HE@AHHPfxIID\H92D9AAt0t+DHHtf/zALHT$艤> LٕLŞkIH5t|1HM@HE1f/Iy/IH919 A:MID$xAI91IG@t$IH@LHI9ǸLDM$HT$xHLL\$衫L\$ D$x"E1LVIH5S{1E1ufIE`IW@AHHf**HLIE`/L1ɺOIH5z1[L$IEP1ҾAH8wu|HHE|I#E`IE`L“H1ɺSIL4IL|$Bf,@#HH1H9HEHD$HHf I E`HH@HHH9/f.HH@HHH9Y/f.LW 1ɺH5y!$CD'IEPH@H@h`A]xL蕒HAPH57y1LY^H LIE`JL1ɺSIH5x1vf8X HHHLV 1ɺzH5x'*fHC@Hft U<fHD$PH4IEPHxwHD$0HLSHHCHD$(HD$L9 Lt$@MDd$8Hl$XL|$H]H1HHD$ L8Hv A|: MLyHLH1 D$(M6L9t$L fA0tMML!Ht$0HhHHcD$(HHHD$ IEPHxvIHJHD$ LrU 1ɺDd$8Lt$@H5wH1L|$Hf.L,U 1ɺa1H5vobH$1 L9HHT$tLDD$tHH蔰 D$ttEp A99$1уt(A AH$Ixt1$A AH$It1$A AH$It1$A AH$It1$A AH$I t0$A A$A@t0$A@ A$Ay0$Aဃ A$A$΃t%A A$At0$A A$AH$$A A$AH^H$HMIIA!LH-s&=סHI11LuLt$L D;d$}I}PD IG(Dd$D$ D$@=IwHL\$Ht$ҢHE1E1jH1HjH$PHt$()H L\$$I0LIH5r1YI=I11LH5rE11L耸LP 1ɺ$1H5WrE1{LE1=H5*rQL]HLI|HAsH5qP1zAYAZE1ɺE1LO H5q>LO 1ɺ LO 1ɺHLO 1ɺpHtH$H>HE@H> f/0 IE1ILJxILJHAA)AH1ɺE1LO H5pV G    } 1ۃX LHLSIIHT$H9&&HE@dIEPH@H@@at EvE 1҉É 9RH QL1ɺ H5o1AZ _AXA;]xNWLLIH5o1 Ht$tL DD$tE t$l@n1E1LH5!o HLTH{ L LpLDHLPL1ɺ1H5nT 1L+1ɺH5n3 HE@Hgf/Yt$lLL 1ɺH5L L\$ D$xL\$1ɺNE1LjL H5&n RLRL 1ɺH5n1E1 L0HLyIS}LHLyISLLK 1ɺp1ɺkE1LK H5am A9mx{tGH$E1E11HLLjjj;H t$t$L7L#;IH5l1` c1HLL{HADH 1QAL1H5{l XZA;]xztGH$E1E11HLLjjj:H t$t$zLOLHIH5k1x{LLIH5k1DGLL3IH5k1fxgHPD$xDd$8Lt$@Hl$XL|$HHT$0HD$PHl$HHT$ HHD$@H+HH DH9\$@uHl$Lt$0L|$8Ll$Dd$(IHl$ HD$Hu1HXPH;HjMHLHI9ufM?I9IWH9B@uAD$LE1uIff/0HXcID$@HizXLȇIL=a1L1L)? 1ɺ LrHj=^I6fDHyDLIZLH$|=H$H|$HBHD$L2HBHD$HHT$HH5YbHEPH8!E H{1ɺLL> mH%H*HE`CI$ L= 1ɺ1LHH xH(HID$@HDHP HtHHt LILH(ULSLDa1ZYIT$H5T`BH`HDhmt{ 71LID$H\$@!L9CH{HL9u-f.HwcL?IJ=HEPH8EuiADHXwH=yH1 LstH5L`(f""fHC fftCff)Hp)HC@HtHS@HLzAąHsL0Im@HDcEHC@DKAt-Hc1jLfH5A[]Im@CH.fChClf8AfLsLLAąu+H5'= LtH5L!f8)t)CCh0)Clft{`$C(/C,AHD$dH+%(6HD[]A\A]A^f.H5L H5< LH5z LH5 LH5> LhH5LQMH-#1E1L3dHL 11HfH1FXHFǃ{*C(1@f8, ,LsCdLC`LDSEDc EH5nLt>H59Lt+H5: LtH5Lu>DjAL﹦hAO1H5el_AXIm@HDfDc ECfDLȶLsCdLC`LIm@H:f8#Ld7fDH5ELH58LzfL%c1H5ցf/sDKhEHN9 HCfHC@HsLuhf)7Hp)HC@H8HS@HLwuAąL 1ɺ1H5! (fDLaH51E1@f&A}DL aDCX@LbDL 1ɺ1H5mWtfHC8SC ftXH 7 HKKfVL`1H51 f&uzLV 1ɺ1H5H!HChH.-HFff.fAWAVAUATUSHHdH%(H$1HHHHIII1HIHu Lp!I} *IHLI}HXH*HH$HxLHHILHLHH) H)։HID$/H^ID$HHXI}LxL(*HLHH1LI$%I}LxL)H|LLHID$ID$H$dH+%(qHĘL[]A\A]A^A_7/$ ATfTfD81E1L_H5g}Qi@I$La`1JH52}I}LE1<%HIL_1S=H5|E1LfL_1BH5|ID$BfID$2f$ۉATTfD~VIօu]t9EHH HHDȸL|HDDLb|H @xf.AVHc-AUIATUHH(HNHdH%(H$1L$LL^xILt$H}PLL7vHtLHT$ L1AătXL^H5,{1E1H$dH+%(H(D]A\A]A^L$ HO{L1FL={x1LHLqHuL9{E1亟H5zwaff.fHW`HHt]H9'H:tH1Hu*ÐHzHW`tƀt@tH1HtָGatH9uff.AWIIAVIAUATEUSH(H9F`D$D$LL\$+L\$D9AtsIV`LHHH9_H:t[EIG@1Htf/LHL+AąsAH(D[]A\A]A^A_HJHQ`tƀt@uH̀\EtHHH9fDLE9IVPANpHѹH9w L$H9T$3H9S1HH9u5DL$L$MDHLLT$-LT$-E1L}AąL 1ɺ1H5w@H(DAL[H]LA\A]A^A_/)L4 1ɺv1H5wwmfHHH9XD$AFtD$1f$ L 1ɺH5'w1E1 L 1H51/ L 1ɺҹL\$LT$HI)EA$HAMt$j]&Y=P^ILM 11H5. MLT$L\$HAWAVAAUIHATUHSHHH}P)HIEt%HAEat HAE9*HHIHuIIL9LMt]AFatVH9tJLE1LH8&Aƅu,L 1ɺ1H5Au+:fHEau21H耓Aƅ5AHD[]A\A]A^A_DALH1LAƅuLZ 1ɺ1H5t蝽H@:H5tIL2u1iHHL[1]A\A]A^A_鹈f1҅H HE1E1rAAƅL 1ɺ1H5 tL 1ɺ1H5sE1̼L\ 1ɺ 1H5s蟼f.AWAVAUATUHSHdH%(H$1Ll$Lh|Edu:AH$dH+%(QHĨD[]A\A]A^A_LuHH5J*ALHtL)L|$1LHHL Ht HH}PLYHHxHL{PHB8LVIH5r1k"fDHE18LVIH5Fr1.fDJfDH7LUIH5q1GAWAVIAUIHATUSHH!DK EH{?tH5) gH0In`HHHHHH{H5AąIE@Hf8))L'V1H5pڹDDCEDH{?7Hs LQ Aą!L5 1ɺ1H5pxCChALAIFPLMtH5`qLL $Cu KhClF9t DQ-DShAwE&E9t1MNHLU11H5oD$訸In`D$t DKdEKC AACu s1҅OLD$\D$L 6 tEL \ t9L $t.ALU1H5R' D$E1H5o11ɺLoDT$ H4$ӷIE@H4$DT$ Hf8,AFaD9s E9E9D9LADHLLyAąK\L 3=HI11L$oH5.nA)DAL 11H5nHD[]A\A]A^A_f.HHL  H&H5mLHRLDHH E1P1聶^_DHIn`H L@AL $CE21E1LbQH5m@V1E1H-lLSH谵H1LS萵D9AE9LE1 2LQQIH5Nl16E1=FI11LSH5lAfAFaAIIH9t1HH9uLH4$`1H4$LpRI'1茴H4$PfDEA)DShA@H5mkA1LPH4$:H4$L 1ɺ1E1(@IIS`H9;LsQ1ͳH4$D97ChHAvHEH5jLZP1Ht$|AZA[H4$9L 1ɺ1H5]jGVfIID$H9TIFPHHs`D$DLHxjDڃ_1AXILP1H5i蹲D$%H5iLNH4$芲H4$KAWAVIAUIATUHSHHdH%(H$HGPHH$1H9HD!I}L%џL薼ADžu_H$H@@HtBf8)t8)t.LN15H5hʱDAEAEhH0I#F`Iu HHCIM HPHq@uH9tu AUD$L2L>VLLCADžH$H@@Ho fMD\$EEpE Iu AmdIu uAE`HAM(AU,WLPAEtPEM|H ADž L@-=AI11LTH5sgbA>f.LHH ADžL 1ɺ=1H52gH$dH+%(4HĨD[]A\A]A^A_H9A1Ln 1H5f賯AMPHC@IH9,HPBs@LAUhAMlDt)ЍzEA1A9D$ERAEt qIED$8AE uAEt3I}H5> DT$wDT$LNkQAEE}EHCEEHPHHE:t{Lt =I}?H5 HT$ DT$H|$(DT$HT$ H|$(LŸDT$HT$ H|$(H5 袸DT$AHT$ fDd IAMdH$u uA]`Ee,ML9AELH eLDT$H]HDA9HeHT$HeHBHD$ DT$ AELDT$)IHH9HGDT$HH H H H HT$(DT$HT$(HLL$ HL$E1H=&QDT$DT$ IH5 1荣L) 1ɺ1H5ZlKL0C1 H5 C",$$IDHt$1E1L\H ALDT$`DT$HD$ H@ HHHLILD1 H5 蘢wI 1LAH5 lKLA1 H5 C"Hp(1HD$ LH(kLA=p3I11LFH5XL$AEpE1AE`1UL\ 1ɺ1H5X蟡~EuIL=IHCHP H2HH&HH1LH=AtxH|$0H'ADžI~PoADžHkHEPHHIFPHH8];ADžH\$`L9uHL9HsH|$0ADžuL; 1ɺ 1H5 ~]L!L IH5 1LHp(Ht$L 11 IE ;AEpsLHt$1L2>I 1֜a IH5 1腛dL 1ɺ[ 1H5 _>Hp(mL 1ɺE 1H5 0LC;HLL>g IH5L 1I~PMoL;H|$0HC%ADžI~PL\\ADžI~P8|tI~P;l1L/ 1ɺ 1H5 E1oNH|$0H}ADžL 1ɺ 1H5 1LL=n IH5U 1L 1ɺ~ 1H5- ٙLp 1ɺ 1H5 賙LVL/= IH5 1聙`L$LQ. IAWL=oPAVAUIATIUHSHfDI$I$HD$H9øHDID$PHHt%zt1H7 LLB!LuA>HCHE H5 L,uuuHC@ = t+HE H@ H@XHt1HLЅLuLL裯u_LLĢtPH5L豢t=H5 L螢t*H5ƅL苢tUuE DIE@Hf8Hu HMtHUpLLM|LEx"9LuLL"t>H5JLt+H5G LtH5$Lu DIE@HfID$`H0ra@I$IL9HL`fDLL HE HLu$I$H9D$BHL`ID$`@|H1yH #HC@uHx(H521ҾLsmLuIA> H59IL讙IE@Htf8)t M'HE H@u RHLzH[]A\A]A^A_I$H9D$@HpHu Epo@LL 1ɺH5L葕H[]A\A]A^A_DL 1ɺH5jLYH[]A\A]A^A_H5{ L趟IE@Hf8)MH5@ L{H5b LdHE Ly LH(1H5K褔H[]A\A]A^A_1LB:H5KlL 1ɺH5TKCHLL[,IE@Ht(f8)ufufufHuH5LftHE @L|L9IL[L9IL:!LKIIE@Htf8)UfGHE H@6Ā-H5 L裝H5ǀL茝LL 9I,AWAVAUATUSHHdH%(H$1HH92IH~PHIDLH(LIH1ɺbAVI1L5`IL8L@XHZAt AD$cH8 L|$It$HH>LCkL1ɺLIL91ÑH}PJstH}PMcAL; 1ɺ1L肑E1f.IE@H5f$'1Lt81ɺL8IE@Hcf/UǃLH7D$ L 1ɺL1DL$ H$dH+%(UHĨD[]A\A]A^A_ÐD$ LH 11`H5G苐DL$ @LLLD$ L 1ɺbIE@Htf$fL 1ɺvLIL61H 1ɺwLIL61xL9HEDHp LIe LH=#7H1fB L641LL 1ɺ 1H5A*fLchCsfAW>IAVAUATUHSHH(LnPdH%(H$1Lt$ LHHBHHD$dHD$0H$FpD$T$IH$H$DŽ$HDŽ$DŽ$ DŽ$(H$H$sI9HE@HfHpHD$Ht$HT$IH4AąHD$MHD$pMtLjHH1LH9HDAąH5;HHH$HLLLIHA1ۅLLH衾AąIG`IL%I F`IH9HD$HD2Aą'1L^Aą2LL-?3LI(=LHI1AT 1L3HXZA*fDAL 11 H5"? H$dH+%(H(D[]A\A]A^A_HD$1.M L1H5>1E1覇@L'I9tLHAą-LLBIHLfHH] AąH5-t; mu xˍfDL L0I#Lt 1ɺ 1H5=跆fLL 1ɺ 1H5=菆~f.La11 H5r=\KLLT0 IH59=1!@1ɺ E1L H5=L01 H5<̅L 01 H5<蜅L, 1ɺ 1H5<E1l[He<11ɿL  HLOIL$@$PH8DŽ$T1;f.LLHD$HtHD$1H$LH@ PXuNMH Lf /DD$L8 11= H58{DT$HEPHHt0{bt'1H HLS+uE1HD$XD$/D$/D$uD$0ID$@H fLL$Mg HD$H$LH*9L$H|$LLL$8gLL$8H LhMs L9M9$ L` IU`@ H1HHMMt H$LHT$8AHT$8t MA$zIEPHHt%`t1H3 LL)-HD$HHD$8HH|$8h` D$\HD$HHD$PHD$`HD$8@H$H$LHD$@H$L$PMH$HD$pPHt$L$D_1AX LV M AEp$HD$DEpHpX>AVLAUHL$L$諜Y ^L 1ɅjD$M EupE9H1ɺ $L/PH 5HHD$P1}_LAXLz6IHLD$p~LD$pMH$HH1H|$h#D$LL$hHt$@11L. s}ID$@Hf/Mk L\LHS D$0 D$3Aup$HT$ H|$;"D$EEc HHtHHH9tHHa,Ƅ$dL$ H$p$$ L$$LD$0$$DŽ$($HD$ HDŽ$0H$H$H$H$HEPDŽ$HH8$(DŽ$THDŽ$LD$0HH$S H}PL5HD$0H HD$0$HT$ H|$ppiDL$ELuPH5I>IH} I>H "+1HNIH HH E`LN*HHH9 @LLl$0LxLǀHǀ&H.r LIHj(1 LH޿>q=H޿L 11L qE1HL"1ɿR PHӥPL$1Ht$`pD$PH PLHL9tf0HL;1ɺ;IH5^1FaLܢ 1ɺe1H55af.HCLt$0LHD$1HHmuaHEPHHtQAtH1H{ HL u0LT 1ɺH5A`RfDID$@HtftH]`$DŽ$D$ǀt H.D$HҜA$D$(DŽ$t H H]`HjHkD$$1HL薠DT$EID$@Hf$/fD$)؉$${ID$@H fH}PwHD$HL(LuPL9M1DIL#I9u @IHSIuHHFH3 H3BH urHNHFH3JH3BH u]tTuJA)HLA){H[HtH{hHtHWHRRhHChI$LM9`MmL9l$9L?L/AL11H5 ]H f/u)f1H=4E1PH@HHW`E1Hu`L  PöHff.HH`w\E1HW`L P~HfHHW`E1E1HaPGHfHG\LW`~ HcILI HW@Htft9HIHE1ɉG\H@aE1LPڵH1ʐHHG(@f%tzf)HO@HtfHG\HW`~ HcLDLH HG\HE1E1PQZYHf.HO@Htft8H@1L1H5M1H1\ff.HHG(HL)H5DH@HkFHкP1hMHff.AUf1ATUHH dH%(HD$1)$HD$HtkIHHHU`ID$u\HE1HlMP LHAXZkHD$dH+%(u?H D]A\A]fDL1H5A~LVAUf1ATUHH dH%(HD$1)$HD$HtkIHHHU`ID$u\HE1HPMP+LHAXZHD$dH+%(u?H D]A\A]fDL1-H5AKVAU1ATUH]HtXHIHU`u\MHE1ɀHwPqLHAXZD]A\A]1ALH5 JD]A\A]ff.fAW1IAVAUATUSH(dH%(HD$1H\$H$H\$H\$}HIHHAw\L`IW`E1HoILP蓱Y^A$tjLt$I9t`L-IG@1Ht1f"@ƋYuMNLLLu荛M6A9DLI9uHLHD$dH+%(u?H(D[]A\A]A^A_ÐL1H5AISff.@AW1AVIAUATUSH(dH%(HD$1H\$H$H\$H\$HD ID-HL`Eu HIV`LHE1IAP =YA^uD-$tcL|$I9tYL-@IF@1Ht1f"@ƋuMOL@LLM?A9DLI9uHLHD$dH+%(u?H(D[]A\A]A^A_ÐL)1H5"AHoRff.@AW1AVAUATUHSH(dH%(HD$1H\$H$H\$H\$HIIHu\LhHU`E1H@YMHP蝮Y^A$tdL|$I9tZL-HE@1Ht1f"@ƋiuMOLHL蝘M?A9DLI9uLHHD$dH+%(u?H(D[]A\A]A^A_ÐL1H5AFQff.@UHHAEt]ÐHLܿIH5Y1AF]f.ATIHUHSH^PIHHtEdtQLB*-L%1LEL1Lq 1ɺBE[]A\uH@X2L*@cuHHt/H&t#Iٹ8L*jf.HȪt1H_ID$@Hf$HL%1ɺLLIL*1DHtEdtDLp 1ɺ01H5y DLO 1ɺO1LDuHtH"=LI11L)QHD[]A\f/Hx H蘩HH=(H1LCfAWAVAUATIUHSHXH^PdH%(HD$HHG`LHHD$Mt^Lv$tR1M|L(H5A+CHT$HdH+%(HX[]A\A]A^A_HT$HLLHLt$臿IHHGLxHEPLHx蟥HH;LHLPH}HL MID$@Hf8#D#AG=w AGDtpL-OL,(1L#B1L 1ɺLB@AL-'fDAupH}PDۿHI|$E$DA$jL-A$$M$aYL ^I11L_AHUPLHHT$+HT$HLPMLLT$cLT$LLT$iLT$HL製LT'LI31@L-IٹLm&L@xL4 1ɺH5y@IL-m1ɺ1L LD@11Iٺ8L&LLT$@11L:L?ID$@LT$Hf/HLT$(LHM LT$HHH9SZH@@@u/LLT$LT$tEa DILE1LN1LT$;?LT$H}PLT$(rLT$]ARpLDHLT$VLT$Y1LmjIٺ`L=6L'&11>L-LE 1ɺL>ff1ɺ0LL e>=H1M!LLh$3>XZ 1HLT$H=c6LT$HT$ dH%(H$x1H|$0HHIvHHDŽ$DŽ$H$IF@Ƅ$DŽ$L$hHDŽ$pDŽ$Ht$Hf@HHD$H;\$0E1LHD$H- EI3H|$eAIcAHl@HH;\$ftHhH}@tI1HL|HI?1HH|H&II9uDHI9HJH9A@uH|$JDE"AHIE@IHef/WLT$A1AyLH5$61LEHt$IHD$HHEHt$EI~HL$@DLAHHHHD$ H$H<HHHH1 LJHLGHt{HxttL$1LH;<HHHHD$ LHHH1蜎L{HLLHHD$1HI~AH$H$pMHAA$$DjHt$ Eg=IH-}H$1L!H1R4H$hH5 LH$pH$hXZ)H$0HHt$0LMHHt$(HHAI}LA$jMELT$H蕚YH_HH=.1 LT$8r 1ɺH50fHDŽ$H$HLLHEPHHt Q)L$L)YEd 'HosHEPLD$tHDŽ$H$#;HL$|HT$xLHt$tL$L$HD$H$LMtLE1hL$IMH1H6LΈ^1LLLIm`4HLL="1Lp Hú[HHD$ID$@Htft HHD$H$L$xLHD$PH$L$$HD$(D$|D$ D$tD$ HCPH@HD$@HCXHD$8HI98IIH@HD$XD$$DT$ ED$ DL$ ALEt$ L! IEPDE< IMhC4H9 D$ H|$EHD$H H HD$`1HHt$HHHPHH@HH H9HGL9IB1HII2H)HHDHD$Ht$8H+L$LHL$01HHD$0Ht$HH9 H|$( H|$(N2H|$@HPHHT$hHD$HH HT$hHt$(H;HD$PHZ Hf1HLx H$1)$)$H$)$kHHW H|$@1HD$(H H\$8Hl$@H|$(OHD$(HXH=HHmH#HE 8uHxH5| 6uH9k Hf.HH@HtH9uH@HAwf1H HLLm 1ɺH5+H$xdH+%( HĈ[]A\A]A^A_L=L%m 1ɺ/Ln+1Lm 1ɺLQ+f.IٹL1H5/+OM ML0LxIEPLHx̍HHtLLH8M}HL/LpIEPLHx薍HD$HtLLH8AoM AoU0I)$)$f.LH=aH1g11L"Ht$HH;n,IH|$@1H\$(LHD$(H8HD$(H m HLT$0HA$D\$I|$jE$A$$M$FY^=IHi 1HD$`HL% 1.!D\$LT$0Aw11IH8HD$IMhsH HD$`HI|$E$LA$jA$$M$LT$ 芇= L IXZHt$`1ɺ!1| IMhHT$8ELqHD$(H L;{HD$(HHt$`RL?  Ht$`La 11WHt$`L 11JHD$#HCH\$(HC%Ht$`LGa 1ɺdf)Ht$`L a 1ɺrl?ATHIUS-ÅHHjLHH,zu>HIT$`Hu*Hx%H-HHw (Hr []A\fDHHLHDbHUIL) 1H5X1Z[]A\DLAEuHIT$`Hx12@LLIH5)117f.I$I9$DAVAUATUSH0H^PdH%(HD$(1HG@HfHHD$HHHT$HIUELt$HL=HTLhMGH_qHEPHHt BMu`I-L{Pv zI4L9HH1HSE1ALLZYHE`H%8L5@H_vLD$HD$ oHL$ HT$LLD$Ht$LL$ 蔫L] 1ɺfH}POL] 1ɺGHLsIHHH8LD$L$ T$H9ǸLL$ t$HDW}LS] 1ɺ1LHD$ Ht Hx}H$=լLI11L3 dJ1H HL< L\ 1ɺH5II9 ID$@Hf/xL1ҾL蹄L=\ 1ɺKH5+L\ 1ɺH5jY@HT$(dH+%(]H0[]A\A]A^L[ 1ɺ H5 fHD$1L[ 1ɺH5|Lh[ 1ɺfDLHD$ HtHx|1L*[ 1ɺbLsfHHH9+4HL5GHhHߕ1ɺVLILS1f.M LQ 1H51ɺLLUZ HHH9a3HHhH&1ɺYLIL1Vf/BLJLY 1ɺHH5$f1ɺ]LLY LL$8L"DcL51LIML1Hk~L!HH5rSIL1!E^_f1LX 1ɺLHD$ HdpL訓H=yH11ɺLLE A q诀1ɺLIL1H5I$v1LIH51I$HHH9LE 1ɺ1H5mAQL5Q1ɺD1LL-D$sLyHHX1ɺLLD 8qtIPtL 1H5 QL1L1LLRhD$LHH1ɺULLC &HL$(LL$0HLD$,H5 2 D$(v|$,\N=L54L11LDL$DL$L ~LI~LH=cH1q#tYH8iDɒEt֌ uyh=kAD$,tI|$@AD$,I$H L1ɺL< WL1t$HL$H3H H,)1ɺLL< @Dt$D$0=QLL11IIH9HhLHD$`L+IoAEhD$0tHt$1HxLw=LI1ɺL1,AfDI$H>#tzHDT$]g DT$t *u fDT$0QAD$, I|$@DT$AD$,I$DT$fDHDT$DT$LDT$0D$DT$uWElffDDt$L"L1 E1H3HL$(HDT$Hɿ &DT$u1ɺLLh: DT$_fD1ɺLL=: DT$L1L hDL$E}H3HL$(H+ HC&^1ɺLL9 >L1LDt$E1L!LD$Dt$DT$I$LLA|KD$X1LHsAȃAAP-HA9DLH9uLL&H$dH+%(~HD[]A\A]A^@*qDL3 1ɺH5:A#됐L1H5Ak\ff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$ZHIHILhL thHHU`MHQL HP\XAXZLH輟H$dH+%(uxHD]A\A]fL2 1ɺH5AfL1H5Auff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$HIHILhLt`HHU`E1MHHPWAXZLH`H$dH+%(uiHD]A\A]DL41 1ɺ<H5As릐Li13H5bAFff.@U1HSHHT1HC@Ht1f/@H1AEt H[]D1Lr0 1ɺH5ͥH[]ff.HHPAEt HfD1L0 1ɺUH5mWHff.fHHHF`t2H$s^tbHËuHDH$rHuL/ 1ɺUH5פ1LR/ 1ɺH5xff.fAVAUATIUHSHLvPdH%(H$1Ll$HD$LAHHE@Hf)Hp)f.HL$PH.H蜁HD$XD$hH]@D$lHf/1ҾHD$p$H|$PD$t/D$xHT$PHt$H託pINXHT$`LH蜫1LHoID$PHHt%9t1H LHt$lHLHH-HDhH1SILlH1_AXDL$lEL1ɺ1HL$xu!LhH=H1~HaH]@D$pH1H|$PD$tD$xH HD$P%DL91ɺ1HcfD1]L+ 1ɺH5B1.L+ 1ɺH5L+ 1ɺH5L\+ 1ɺH51{f1L+ 1ɺHc`f1HL0-AWAVAUATUSHH $HXH|$H\$0HHT$Ht$dH%(H$H1HH\$8D$$ H\$0$7L|$01I9D$E1Ll$(Ld$,/f.=A1|$,M?I9t;IGLLD$,D$(Hx@tыD$(=uD$fDT$EEtf $ tDHD$H@`H%H&_H1HD$H@`H%r H&- $E$%uP=xLwRDL$1H5T1AAXAY<$<$HD$AH$HdH+%(HXD[]A\A]A^A_fDH|$AcLh ~IH5ĝ1f.1E1L H5yb@Ht$HL$Ll$@HbLHFPLNHHhL1? D%\wE611Ht$$L$;L% $LLEҁ$AɉR%=wP11^_H|$3b1ɺLIL1c1L1ɺL濄FHD$H@@Htf/4$1H=9-\H|$E1`LIH51=FuL%ޚLs1L1D$$;$dHLPDL$1H5sXZZAWAVAUATUSHH $HLvhdH%(H$1h"HIHD$tb1҃KHIFHH H H9H$dH+%(iHĨ[]A\A]A^A_ÐL$Hh"1Hw L <LH5/TIHVL|$L꾀LHt>HMemTotalI9uA:u1HT$H5LifLhHT$H KHIFHH H H9HHH{HIt$hjID$HL%LlH1L濄IXZAUUE1L,gKTY^HHHHH9dHC@Htf/M1H=3>Nt=bI11LdH5q`?f1LQ&L 1ɺH50HT$HdH+%(HX]A\A]A^f.LMELIH-ه1HfLXMlL_IfL, 1ɺH5qMLXLLLQ=aI11LH5+HE`H}E1LHHyH)H-L 1ɺbHfDLhL@LIH-L"1gHqt@H-mL 1ɺrHFIH-EL 1ɺOH!@AUAATUSHBb@uHD[]A\A]IL-k@HHH9ǸHDA HHHx CLH{j1jLAE1pC,ZYLHHuId$`1LƣAŅLAJ%=_I11LH5/HD[]A\A]ÐHJL]IH5= 11E1LH5HD[]A\A]@H{/JLH1ɺcIH5< 1[fDL4kH5w< .hf1L 1ɺ#H54HD[]A\A]ÐATUSHdH%(HD$1D$FcHHIHt$HH &D$0DCL)EuuxWH[HI IAT1ɺSILH5d12ZYD$tHT$dH+%(H[]A\fDWH[HIHAT=C]SIH5L1ɺ1^_|@HPHLI1H5y1WfHHLIfHGLIff.fUHdH%(HD$1HD$t'HHt$H$tiHL$9uHT$dH+%(udH]HXGLIH511DL 1ɺH5Y1AW%AVIAUATIUM$HSHHHoM|$HdH%(H$81H|$HBHL$HA$oJLHD$LAL$oR fod$fol$ fot$0AT$ oZ0fo|$@A\$0HB@ID$@"jr z0HD$PL$HB@BtL$AD$t$BtBxAD$x$BxHBXID$XHD$hHBXB|AD$|$B|A$$HI$H$HHI$H$(HL$yH<$HyLHy1LLHa01LHLI0AŅtRHT$1LL00AŅAH$8dH+%(HHD[]A\A]A^A_L 1ɺT1H5DDAL 11QH5fL| 1ɺW1H5[%DAWAVAUATUSHLnPdH%(H$1HG@H'fHHD$ H HHT$ IIqH\$ LHeHlLpM_L9LLmPH]`֩PHHTHH,LL=}iCHLUIN L1AXAY1L' 1ɺLpH$dH+%(JH[]A\A]A^A_LEPIF`@uOAut}ItsLBc LrI1DH-, @LxBZ L~IL=|1L fA~sH%H-HHMHL} H|$0LDH/ 1q Lu<HEPHHt-(t$1Hc HLoL={TIFPHHtg1Hjc LLnKLKA{ LIfL 1ɺH5r{aHD$ 1L 1ɺH5<{&@H@L/pI1H5zwL@T L_c IIٹLa|f.HNH(@k LIL谢LHՙwIHD$Ht1HDHD$tI HD$Ht Idž HHH9øHDID$@Hf8#t%D#D9[TtHH9D[Tf/wHt$(H)KHT$(LL!LHNJ(HD$(HL$LH ͣL͓f$HCD\$DLH@ @\D\$HD\$y>t$LHD$sTLIHT$1LI1R AWL=xL{ID$@ZYD\$Htf/HD\$=H=H1^H5cL Hzt+H5ș HgtH5 HE1QAHD]A\UH.H5j@ H)AEtH5m H ]ATAUHH.H5 Hݷt+H5HʷtH5HE1贷AHD]A\UH.H5: H艷AEtLUvtKlu}vtpptSH5HTAEtH5jH8]fD}gu}u]f.}vu}u]D}u]ff.ATAUHH.H5H轶H5 H覶H5H菶H5 HxtwH5 HetdH5d HRtQH5 H?t>H5H,t+H5HtH5HE1AHD]A\fATAUHH.H5H͵t+H53H躵tH5HE1褵AHD]A\ATAUHH.H5HmtdH5HZtQH5HGt>H5H4t+H5H!tH5HE1 AHD]A\f.HHH2H8۴ff.ATIUHH.H5 H谴LH HDHHtH@HH?H]A\L 1ɺH5h1ff.fAU>fATUHH@dH%(H$81H|$@Ll$HD$0Ld$@M)D$)D$ HLHHD$P1LH1HL$$Ll$UIHHHAE1ID$HM11PHATjH$cAH$H HtHxW HDŽ$LH`WH$8dH+%(H@D]A\A]fL, 1ɺBH5AkfL 1ɺGH5A;vfDL)?1OH5AAlff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $1HHSIHHHAE1ID$H`k11PHATjH$bAH$H HtHx HDŽ$LHUH$8dH+%(ulH@D]A\A]Ll 1ɺH5!A諦fL=1H5Av߰ff.@AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $1HQIHHHAE1ID$H@k11PHATjH$w`AH$H HtHxHDŽ$LHTH$8dH+%(ulH@D]A\A]L 1ɺH5AfL <1H5aAOff.@AWAVAUATUHSHH8dH%(HD$(HG@Hf!f#HUPD=&H:E"LMhupDExHE`1Ƀ}tAA1E1HɃHASATAPLTQ1VH5 AQLhSARP1RuHRiH`HD$(dH+%(bH8[]A\A]A^A_f.H#tHC@H1HHj2HC@Htf)tL%} 1ɺ1LLcHLL=TL5UI9fHI11LYL HCH@ Hxpt;HEPHHHx+1ɺLIL1ɢHCH@ H@HtHHL9S C$MLLЃEbPME11RrHSY^HB Ht HH'LJ(&fDHHE1E1j1HjjH HUPD4$LMhupDExEtH:E1ɃHE`Dl$E1D\$\$HDd$ EAIL AfLW1ɺ1L蓡fDHUPH:HHG@Hf#tIf#uf)L'1H5Hfu f(tLM4빐fufX*ufuf*ufuf#tf)uFf.HH1E1PE1ZY`fHLͫ9ff.ǼATSHHH6dH%(HD$1H|$ut1D$ACC HD$dH+%(u7HD[A\fDALY 11H5(蜟DATSHHH6dH%(HD$1H|$u9t1D$ACC HD$dH+%(u7HD[A\fDAL 11H5 uDHH6HHfSHHKt { t [f.1L$H5茞1[Hff.@SHHtS v[D1LʩH5 1[Hoff.@SHHKt { t [f.1L$H5茝1[SHHt { t [f.1LH5,1[SHHt]{ L¨taH9Cwu[ Lt>1҉A uvSu [L1H5|1[ALQ1H5F1[fLYff.fSHH0tS v [f.1Lr/H5X̛1[H@SHHt { t [1LMCH5d1[SHHpt { t [1LQH51[USHHH.U@uUH1tHtH+H[]ff.SH>HF E1t C AD[@HF H>Hff.USHHH.H5 HtUH5HuC H[]Ht1{ H[]C H[]D*h}txu5~2tL1D1oDfDtu(D?vt[1øNtOu1D1DD@f?puvugtHH>HfUH-&1 1SL N HLHhdH%(HD$X1m uK11L 6 LH?HD$XdH+%(Hh[]H1ҹPH5(H/HtjIL-1H3 1ڗ iPHo#TIL1H5 1藗/fD$O@AWAVAUATUSH1LHHt$@HT$8dH%(HD$x1HD$`HD$HD$hHD$`PJIH@LHHHHI9tDH;htHI9uH{HtfHhH|$`?HT$hHt$HPHT$hH0HHD$hHD$xdH+%(HĈ[]A\A]A^A_f.ID$Hth I<$YLQL11<H50Ld$`Hl$M,$L;d$uIEMI9t9IH1IT$HHuID$I$MHBHIEI9uLd$`I$Ld$HD$M9HD$\H\$HH\$@HD$ $HL$HT$HL$HIH9qHD$I|$Ht$ ޤtʋ|$\tL+ID$Ll$(ImHD$0L9Lf.HEIH9HM}LL~uI $ID$Ht$8HAHIMIEHAHH>KHFHT$I4$ID$HFHHVHT$0HtHHt H9HMH1H5MPL1WdHHD$8Y^H;\$(H\$Hf.1L1ɺpH5L-EL|$8oHD$8L0M&L9uKI$MM98IInH1HHHPH1HHHu}d| HUHH9HRPL1MR1ɺwH5\IIFHBHXZ_HD$0H@apXH=5IL HHD$(HD$@H\$HL Hl$@L-L9d$@DML$M1gH56賒M$$I9ueDHYH@HD$@L CAWAVAUATUSHHH|$HH$L$dH%(H$1H$H$H$HD$xH$H$L$L$~mLzDTHD$HH@@HfH|$H$%=u>11Ҿ'u,L LH5ZHD$Hh2BH|$H$%!HD$HHHD$Ht8Hiu,Lۧ hH5[ݐ_HD$H1HHHt$hH9tHHH9u BH\$HHCDHD$H4HD$HH@@H<f 4$ !DŽ$H\$HHݲ 蘖HHH9l$hLt$hL|$HHmI9LmMt1L`tIEH+L9"LH11H޿L2襏1LLIHuA}dd IUHL9LJH1HPL1HHmXZI9FH\$H11H$L=r IHHD$)HH$HD$`L+H9\$hLd$Lt$hMLl$HHkH EdHT$`HLDKEPZ*HK0HS(L 3 HC sHIDHҍ~IDHIDfwHM 1H5Z*=VL"H5Q1RP1DŽ$D$ H H$2)IHt2II9ufHI9L;XufDI$LM9taIL ]L4 1ɺH5yH$dH+%((H[]A\A]A^A_Ld$HT$HHH9HD$HH51HH@@Ht 1fH\$HHt$xLD$HQHt$`H$H$HD$8H$H$H$H$HH$Ht$hHD$H$H$HT$pH$H$M=H\$hH|$8H.=HT$HHH L|$H$H$HD$XHHD$PHT$@H;D$8H$fDDmfAt_HD$@L9tUIH@Cft6fA9u0H} Ht'Hs HtDeD;cuG HIL9uHmH,$H;l$8uL|$Hl$XHt$8H9Hl$HmHl$H;l$8f}uHD$@L9tIHHIL9tf{uLm0MtLs0Mt܋M;K $uLLLH $uMLd$r W*H{HM LC HMXLHLD$H $HU(Ls(H $LD$CH3Mf+LHLD$HL$H$HL$LD$Hs0H$HHl ML . LDCxfwHM HHrQL%̪L4 1ɺL8y|$ LC0Hm MyLDMLDH fNJL { fPH*E*=; R1APLVH5+AVAUP1xH0DH" IIADH=  JIL  IfL AɺL@?H=D*譄kHM HK0L5a HZ ML  LDCpfwHM =B HD*HH59P1Q1RaAVAPL9wH0D$EQ HD$H LI1ɺ 1H5ڨWwH f9 LC0L EEHH=b HC0HDH=S JMLDML y LDf=<LՋ1ɉH C*RP1ASVH5 AVAUvH0HD$Hh2SL1b1H5avHHCHBHEL@1?H=uB*蠂ALD$@?H=GB*rD\$4$HC#HNHHBH99HRIHL9 LHL\$H1ɿRL1H5suA[[E1Ht$1HLL 1ɺH50usHL$H|$HL$)Ht$HHHA9=3H-,=7IٺL%411LҦLttME H MHS L  LDMLDCHfwHM H@*L[1ɿPH51AVAUR+tH HUHEHBHHHCHBHH$HD$pH$HEH$HEH$HH$H$HD$`HH$HCH$L L$mHk華aH HHs L  HDMLDHHDMLDCxfH?*=PLe1RAVQ1AUVH5sH0E1MAHM(H4 HHu HDL \ HHDExfH>*=PLf1RQ1VH5~rH NL@H1L$@?~L$mQEHHC0MH= JLDML  LDfwDH IIу=]H9>*HL31RP1VH5AAVAUqH0H7HH+H9"HRIH<L93LH=L؄H11RH5΢KqAYAZH|$HE;HC0HH=r JHDML  LDfwDH IIу=PLlH1ɉH=*RP1ASVH50AUpH0H=- HHDH IIHM 2HD$H zL܇1ɺ1H5:pDH IICHM ]LeQH5moq=FIٺL%C11LLoHH54 L *MHK0H wH;H/H?EiHC0L "fHHPH|$H11H!HHpu1Hv~GH|$H1HHHHD$HHH@HtffHH|$HHAHH|$HL 1ɺGH5֟1QnL HU(Ls(HMHs0Hq fDHU(H[ Hu0L  HHDHHDExfwHM H :*=1PL1VH5(RBQ1mH L QHU(Ls(MSHMZHs0H H 5f9\HC0H5 L1H5m=qL%vL >11LӞLlHD$HHHHC0L fx3fƄ$@)$ )$0rHD$HH@@HfxHP1Ht+-t!Hc4Huރ L1]H5uktLC0H58 HHRv=+IٺH11UL%LLkY^aH HHK L  HDMLDMLDCpfwHM =H7*HLPH51RAVAUQ1kH0HS0L5V HO ML  LDCHfwHM H7*1ɿPH591ROAVAPL~jH HS0H H ML  LDCpfwHM =H6*HH5P1RjAVQ1APL+jH0mf9*HC0H5d HLLD$H$utH$LD$ HS0Lw 1ɺEH5:i>}d菚 HUHtHH9tCLJH1ɺ=PLH51wiAYAZHS0L5 L % 1H$,fo$HD$Hfo$H)$ )$0H9D$hH$ HP0HtzH:HrH39H3qH ugHrHRH3qH3QH uRHPHHHH9LHLŀ1cH5xhHH9D$hoHD$H@Hx?HfL$ @ H$@@0fo$ Xfo$0`( Lt$xH|$HH(HH$HPH$HLH$KH$Hl$HL9u?*@HHsAHHHH;\$x@HM@Htfu1ffHLM?H6;-A<$H- AHL{qnAHfAuރ1H-GL|HfL[ 1ɺH1f$DL QD@LfAHJ<(f9fƄ$@1)$ )$0HHY-tKHc4Huڃ *1H$fo$HD$Hfo$H)$ )$0H9l$hL$ HE0HHHPI3 I3QH HPH@I3QI3AH HEHUHBHHD$HHH9D$hHP0HH2HJI31I3IH HJHRI3II3QH p(L~1u(H5Xd_AXYL@1H51d0oH $H5 H= 5gH5 HgHD$HHH9l$huHmH9l$httLu MtfD;muHLnuLeMt5H|$HL#t HD$HH@@Hf/Lu HUHELHBHPH-BSL}MH1cZLB Y1Lk|1ɺ1H5qcH_H5u HfLt$H11HLCIHHL"tIF@HTf/FHD$HHH9D$hHH9T$htcHJHHI9uHUHEHBHH} gH}(gH}0gHgH|$HHD$HHH9D$ht#HH}(Ht HltHmH9l$huIL1H5/bLz1ɺ1H5 bL 1ɺL 1ɺzL6H=wzH18.H\$H11H;HHcH SHC@Htf/1HH=Sy7 HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1LL$ H$$D$0L$HD$LL$/ЃLHcHO@HtH@Hf|(tHHo VLH1LV H5b]XZHT$dH+%(u&HLIHcz1h@SIHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IA I<@sHW@HtL@IfB|(uffDHH=H=t=(~gt=u@Isf.IsH$$H$H\$H\$ D$0H\$ʃHڋt9Q/vHHuH1ARLu H5{MHL[XZHT$dH+%(u H[10fHcH" LvIBD(t2HOHHHH9uDDH H9tJtf~(tFHO@HtLfy(t͋AAWAVAUATUHSHHHdH%(HD$8HAL0LhHhH$?aHM@ LcH\f!n!fAF4xAf+t+FA@HCMFIVHpfL{t1H5r^ZL=b1ɺ!1L L:ZL֛ 11LZH<$uHhHt1H`APHT$8dH+%(HH[]A\A]A^A_I@uAdžxDHSXH7'HM@xAHFAf1AtIEA9ADHE1PL=aL 1LYHM@A[A_HCMFIVHpHcLHLM@MtgfAx(t%E^,1ҾHD؃AF,fA(tAN,fAtHfEEM~XMLH,HL@MvEEI}M~`MLHLD$HHpLD$HFd LL=-` 1LsLWH;H5 IHHMAIHJ *H)sA>8HI9utLHH趂 LH3IuH IuH AU  HIAMiH#HcH>IAF4@xAdžFAfDMN`L;MLHLL$LL$HLXMACe IG@Hu fg L9Ld IL=?^1LULa 1ɺ1LUE} EH;HG@Hf&1L9 H AFp1AAFpLqn HAAFH ujH;AhA H5rAYAZ|EE EPIHHUHCMFIVHpIFPIF``c L=\LqL2TfL̕ 1ɺ1LTfDAA@AE^,DAF0kHHH9.HAH9uLv0LSD1Ҿ@!LI9IHJE~pAE <IAH(\(HD$A‰HHHHAMHAA,L L5qHd LDL= [1LRL. 1ɺ1LuRSAIH(\(HD$HHHHHAI@ t~AdžE7AtIEL=QZLqhp(AFpPHVH HV1LATARP1QEH0EE1MfXM$AE~xqLqEH|$ H|$DAA;HHDHDL$HxjշAIHHDL$Hx$茷L<$= L=YI1LLp~1wPEY^fDAVt9r1AUAVpwE1DAԅYD)Ѝ9E=fL=]XHL1PLip1OAFE)A\A_AEtEE IH@H)EfEFEtI@ HHtH5~YI@tpAH L@(Hօt IVXH5 IF`MNPH I~HHHDMLDH1APLbqRVH5?WWP1NH0HHt/tHE(fxCANDLH^hHH2I~PHRHIVPrDAH(\(HD$DHIHHHHAA9HHDDT$$L=gVD\$HDL$Hxj覴='LEH$1ɺ1L7 MXZD\$AMDT$ED@E>E\ MfXMO LH4HH@HD$HL|$AvxLAH(\(AAGpHIHcHHHAMHD)AHD$EAAFIHT IHAutuo@u IFxEMHsXH;PjjAZA[L=TL 1ɺL,LHIFL 1ɺ1LHfDHIMAHHxIHL=QL4 1ɺL}HGI>EL=PYfL=PLՉ 1ɺLHfAvptBt<A9v)Avpf. xLdL=P1LG,AV1fHHUqL=OLiL8GA HHHH1H1IHHHH9HGI9IFHD$A9LAEMA$MxDT$HMLjH L=NbHt$ IHDL$Hx$1ɺQLI1L$$LWeFAYAMAZDd$DT$L=dNLd1iLELu 1ɺ1LEHHL= NDL$HxjUYLc^InL1PErAN IHA^IF`IVHL wH5{MIL gHq(LE11R D^_~DH;HDLL$L=MHjzA]LaA^IL1sDL 1ɺ1LVD4AɺB1L=LL. L'DfI99IHJA@d5IH@`L=DLL^1LCfLL 1ɺ1LCqfDI@L=KL1L"ePC[D9D1A5B9Hr(L=KDHL1L5`BA[A\wf.kDL=4KLe 1ɺ@LBfLcL=J1LyB@L=JL 1ɺLNBfL=J1ɺ1L̃ LBL`7kf.L=TJL2c1LA|@HML[L=J1LA^_DLȔ+IAFIFXHJH;AL=ILȂ 1ɺLAz@Li^L=[I1L@@LQ`[3fIIL9\HH@HIF`DIFXuLcfI@jf.L 1ɺ&L=H1L,@ HȼLZIL=hH1L?9fL| 1ɺL=4HLb1L?@ADHt$HM؉jHLTA IHH DL$Hx$IHIDL$Hx$ϥA[A\AUAWIL=HG1L]JL>A]A^"@L=G1ɺO1L< L>L(LgYI[L@\RLHHtH@HD$HMLM vhLLD$cLHLD$KL蓺hL"ZIf.LLLD$мLD$LKcLYILS^L=EL 1ɺLJ=(L=EL~ 1ɺ2L#=YL=EL~ 1ɺLHUHDPuH1[]A\A]D1@CB LHIjDI9,$tAUuH=vdCH9vVHH9HRHFHCK HSH[]A\A]fDHAf.CHfDSHHHdH%(HD$1HtH$1:u 1{ HT$dH+%(uH[BfDSHH5L HH;dH%(HD$1Au1HCHT$dH+%(H[f.HH%tAH$8u8{ t2DKAvU1Lj[H5pf611Lzx 1ɺH5Kf61d#AUfSHHHdH%(HD$1Hyt%H$8u{ tH9CD1HT$dH+%(uH[@HHdH%(HD$1H t H$8HT$dH+%(uHR@fSHHHdH%(HD$1HtH$1:u { tHT$dH+%(u7H[f1LhH5d\51?USHHH.H5edH%(HD$1H7teH5p H7u*C HT$dH+%(uDH[]HHtH$1:u1{ C ?DSHHHdH%(HD$1HytH$8u{ t1{1HT$dH+%(uH[>ff.ATSHHdH%(HD$HGpu8D`Avu-HHt&H$8u{ tE1{A fvt+E1HD$dH+%(HD[A\fxguL#H5fcLX6t$H5 LE6u!C AfC A뉐HHEAąrH$E18bE1{ AR=DAWE1AVL5))AUAATUSH(dH%(H$1H|$HHcHHD$H0Hf.El$E9|,EHE)AEIcIH86uuAFult DL$Et^AFENLLPHHkFLP1Q1+_AXH=LLwH8J;H$II0dH<$HD$(H5A0Ht$ H HHHHH (f|vUH5H-GHH1L<ƃHHLAHHuH/HD$ 1E1H5N^H-f=IH-42&H\$02H5ُ 1}-rAI(A9mIcFL<@HIBT=#҈T$tH5 15-T$1JL=H5 -I>t H-H<$Ljeft!Hf9H(H9uL5`111MH5[],Lt$ MMHI0H_AAtrft&HoHHTfD9tH(H9uAWtH5 1T$+,H$E1 HtT$9t*AH(A9uDH5A 1+@1LDT$H5 +LcT$H4$KH Ht HT$+H<$HT$DH H|$ *D$D$uWt$wHD$(@HD$8H &H5֎ HH<2jH=N*D$D$HH[]A\A]A^A_H\$0frDD$L=1 L5; :DH5 1DD$*DD$AH(A9#HcCL,@D$IB|-#uL1DD$o*1JT-L[*H;DD$t *t$H<$HDD$\M1Lt$ MDHI0H AAtft&HHHTfD9tH(H9uA~uH5 1)H$E1 Ht9t-AH(A9uH5ɋ 1m)PL1DD$H5 E)LcD$H4$KH Ht HT$V)H<$HT$DH mxH*HHD$ d( LxR1ɺ1L&D$H=K)(ILJL1%qH5J1i(@AVAUATUSHIՃtNH:1AAI|11EDH9HD[]A\A]A^@H:H5TH|$/H|$uHD#H=o? H @H;H(BH9uH=>K'AHD[]A\A]A^L%3T11LCXh L$L1LQi o$L1L j O$ L-Wif.HMLHo HH(pL1#;-XZ|A@AWAVAUATUSHH $HH $HxH|$HHHt$/HT$ dH%(H$h"1pHR/1H$HC@HC HH H5\(HHHfHHH|$PHH|$0L H HBHFLPH$`HD$(HPDHx t8LP LE1fx&AHFDVDX#ƒEAEH FHI9tJAHH@HLDP#EtDfx&tG:HH$`H|$PH|$0HHD$(HfL-V ))FH5 H0H^HD$HD$ HL$(E1HT$0H0HD$87+Ņ(?HD$H=\ E1A:@XL`&Dt~D{E9|6DD)DHHI|DLD)D ,yDsE9}H1AULgUH5PS!XE1ZXfAƒ:wHH5=(AD HHHftHH5tHHH(HH JH(HHvfAt4H'fAt%H8fAetHH)HNVHHL$8H|$HHL$8GE(fE(HgfAtH8fAtHfAtHfAtHfAtw#fAetfARH\HofAI.HA+HD$LDKH5MH@@1E1H$h"dH+%(Hx"D[]A\A]A^A_Ht$H~A)H~Ht$ HcHH릉D$HH~LI0H5LLGQ1^Y^DT$aHH L QDT$HLIQPVH5L1H DT$Q#HqH1 L PDT$HLIVPR뢹LvPH5LDT$DT$fLI1H5KDT$WDT$\H IH ILH $H5ea H=va q&HG@HSfhHtLJ($t x.ftx+t#ǃǃ҉f tH k [fDAWAVAUATUHSH6LM@MfAX-t DžA/fAth(H(HHfAhtDžHDžHE @ t@ t(H 1҈:H 1҈HU JH HH ‰H,H+H HH#H H HE@HHt7fHfHtftH1ҾHHtH5 #<f1ҾHTH]@IH$Hf+tzLc`ftyH5 L# LYF1ɺ 1LzFH5MHH]@Huw1f.fuH5n L #tH5Hp L"nH5L" L6FHtf8fh  f%ҾH 1҈A1EUH 1҈HHH5 H"tH5Rv H!HE@HHnfHt)L MA<$NH { HLLLfHHt :H]HLmHI9L= 3LLHHtLHL9f0tLMtL,H}HuLLuLD H5E1=AHD[]A\A]A^A_D@L%m H@LnLH}LhLxHLLLH#LHHE@LHmHU@HfHfDHDž{HbHE@HDHHHHH@HE@Htvft Džft3HH$1ɺrHHZHE@Ht%f(tfht DžH`H~`Hd`HJ`H0`oH`qH_WH_=NH_#DH_ H_HE8pu$xvuhHk_HE8v'D`AgH5_fDL%wBHLML@11 H5ALgfLtF f.tL}@ LHF1 H5AAHDž L|@E1AWAVAUATUHH=GSHHt 8HVLm@M,1fAxxHE(H5Qw L LH5x LH5+ LH5w Lt1H5 LtH5- LofA8L5FL%@@fAxMPLHT$ )T$ HI3H@H! L1PL E1LMESH0LXZH8Ht*1 fDHHPHt92HPHHuLH-ADž:Lm@MHt@HHXIHH8Ht)1@HHPHt :HPHHuLHADžHAv11L DG LL:DEH0Lm@LAYAZMfA8IHHIH[H8Ht)1@HHPHt :{HPHHuLHADžHAt$] 1L CL{C1ɿH5=xH0LXZH\ADžAHD[]A\A]A^A_DIL%=11L< LLm@M'fAfAt>HL%P=1ɺ6 1L.CL Lm@Mu_1L%=HeHC SL BL;BL1\ A[[@L%<fAtIZffA88HM&L%<+HPH3HQH8H@THL ALSLA= 1E1 _AXRL0,@HPH%HQH8H@cLN 1ɺb 1H5;G fH5C LIH5It L2fAHL%u;1ɺ 1LSAL Lm@MY1HJIHQIG1L5@H1L PL @1Lr@x H0LY^ HfDHPHHQH8H@lHY 1SH5:L I@L? Y^L9 H5Z:1E1 u@HHM( AULn?.HT SL ?L?H59L5?1L5?HMLAULN? |HE1|L5M?NLT9 ff.fAUATUHSHHHtgHL-{HtH9uCLISKT%HDPuH[]A\A]DEH[]A\A]ÐLhf.L-){HHG(HLٙH5_DH@HkFHкP1 Hff.SHHdH%(HD$1HH$u4H$H HH%H)Hv?HT$dH+%(uTH[ÐLH5XHf.HH 1E1PE1hZYHAWAVIAUAATUHSHHdH%(HD$81H\$ H\$ H\$(uHG@Hf(-1HIHHHXLHPE1MDPHhD$ZYf%f=tgLH\HD$8dH+%(D$HH[]A\A]A^A_DL71H5mWlD$fHLHD$I9u|HL9mfxuHD$ 1H9VLd$IAHl$Hf.MeH\$ DHI9t H{ Htf{uLP uAMmI9uHLd$Hl$E%=LYHLiV1ɺ) H5L O%=rudH WfDL1$H5UD$+11ҾHf6Lt$ 1I9jLd$H\$DLMfM9uMmM9tvI} HtfA}uLuML@511H5M 3 CIUIEI} HBH+I}("I}0LM6L;t$[Ld$HwLT1ɺ= H5 s-ff.fAWAVAUATUHSH8LiHt$H|$AudH%(HD$(1IEHD$HH=H\L`MOID$`H"H!L & Ht$ L(UIl$PHHt BIUH|$LdAMHa L 0IULb4H5SLDIEt$=R^AQ1P1H HT$(dH+%(H8[]A\A]A^A_DLt$/LLGLHXHIDM9u0HDt$ L3LL$ #DM?M9tMwHIFHxH\uHD$H-L%L5HυfH|$1HV L誥L.= 1ɺYH5RsfL  L271H5zR5L< 1ɺ\H5IR H1t$ LL$ L11H5 RXZCML$H>L2X ff.AWfAVAUATIUHSH8dH%(HD$(1)D$HD$ ^L*LbLtILSÅ)/L Ht&LHsIHtHLiL/L/HPHLEHHPLEA}-A$I<-LA}LI)L9A<$L24LS+L3RLLL\$,H}LxL[HLLHLHD$H}LhL[HLLH1HHD$ 蒤IH6HD$HE1LID$H11PAHATjTLHD$,H D$ LIU<-IջL01H5YOHT$(dH+%( H8[]A\A]A^A_@I4$1eMl$/Md$ILHLHqHHxLHeHMSL/fLi1H5NL@/fDMeIL8 1ɺH5ANLy/f.HMAWL01H5MXZLl0H5MnU@HMAWL/@1ML/H5^ML /]ff.fAWAVAUATIUSHHLo@MtfA8M1HHID$(@HfwHwQHcH>f.L/VH5K1E1IHD[]A\A]A^A_Il$@1HtftHHCxHfC1f/C1f$C 1fCMLH5M E1LAƅHBc LDLsgHCHH;Il$@Hgf8)0)kL/DHdIl$@ClHCpD$ Hf+f H{$E1HresizeHC$L=Ͼ GfDG GCIl$@LAƅHtfHmanageC<HK41fK@CB@T$ Il$@2H.fX'<'ChtP'SlT'Spf'H'HS`H'L-CpSlJfIl$@HtZftHHCxHt D$ vDIl$@D$ PIl$@HuD$ H{$1L=C HchecksizHC$Gefw GiHIl$@HClCE1;lf8)&= AL,11H5G7HfHHH5 Ht*H5K HtH5 HH{4H{C CMDCTHCXAfD)PE‰CPf&tP|&CTtJ&L ,Et't"L,DCTf&bH&AHCXH&L+fD1Ht 1f)C[@E1+1f^1E1H-EL)HH1L)_v(L*1H5ELf LpMH58 LL=8 tUH5w LL= wt;LLht,H5DG LUCH{$4DH{$LCHC$@f&f&E1@1ɺE1L/ H5DF1@fLEf.LOEqf.AUAATUHSHdH%(H$1HHtO1H芙IHtbHXHHU`HE1MHPTHLHAH$dH+%(uHD[]A\A]ÐAATIUHSHZW\HvP~HHHLH^t@Li:~IL(11UH5BfD[]A\fDHG`HE1HHyHHiL. 1ɺNH5BJLhI}u+1L(1ɺUH5\B []A\1L'1ɺUH51B:IL'11UH5B ff.AWAVAUATIUHSHhLjW\dH%(HD$X1HvPHIHHE`t H$UH%r @{HEP \L0uRL'1H5HAHT$XdH+%(tHh[]A\A]A^A_fDH}HE1E1jH1HjLHD$8PzH AD$ E(fHE`HUPH%L2*@L1ҾpL1Ҿ_Aƃ1{c"E/HE`H%@'Ht$ HHD$ P H8T$^LE1ҋD$5i@B9'i'L'H5W D2dD9ALH1AVSAA1ARDT$,kH EDT$ ELHLEMZAE;HeA={zI11L$H5C?@HRNEDHG`HE1HH豒IHKL=* 1ɺ9H5>LEXML¾LsHUXHEPHLSAƃ1AL%1ɺL=9V 12LEHHH9THWHB HZHHNHH@L#f.HE1L%1AV2H5U 1SARDT$,^DT$,H EeE1@LEXML¾LCHUXHEPHL#Aƃ1AL#1ɺHt$HS% HCLE1҅L=T HYcL$LI+1K1HT$ H;HHH9HHPhKHt\HfH* c^Y ,Ѕt)Kt@x}9Oи)HiCH2Ht$ E1ҋVw/9Ni@B9~ i'D DPE9ELAAFH>DT$ D$HDT$ HZ(HbHL4#SI1H5lS 8XZ1L& 1ɺ!H5g;L"1ɺ 1H5S 1LP<1ɺ$H5;@AL"1ɺfHPXWLBX$HPXgLBX4L% 1ɺ1H5% ? f.HЃfHH H*Xf1L% ~H5% L=R L% 11&LL=Q LU% 1ɺ(LfL=Q L%% 1ɺLn@AVAAUATUHSHdH%(H$1H\$0HD1HIHHXAHHHU`E1SMHJZY$Aƅu\LHYH$HtH$Hu_H$dH+%(HD[]A\A]A^fDA.DŽ$ASL% 1I1L L濄H 91H|$jLc1H59SL N QH  UQH 5M QH B RHl$XH01ɋ|$HT$ H~Ll$ Ht H}DLD$ L1L9 AaIٹLL? 1>fLQ 1H5^7A=A]DIٹLL|8A,/ff.@GAVAUATUHSHH@dH%(HD$8HG@H/f!!D RE-L-L%8uEtE1HH{HhLjHuhDtFZYIHEPM= q3H561HAVAPLf7uHP1SATtH0HD$8dH+%(,H@[]A\A]A^f.H^tDPEHL$HE1E1j1HHjjH |$HHtEdt;L-6|fDHL%6vEdHr6LDbuhHt$ H-|$ u!f1fDHH LtZݸָϸL-5L%5AUATUSHdH%(HD$1D$$FaHI1ID HL$IHEutq|$tjHBDCLʼnEh.M1PL1H5i5saXZ|$u61&1L%H5!51HT$dH+%(uPH[]A\A]h=TnMPH541sL +1Y^[%DAWIAVAUATIUHSLHAA@I@(HMLLPAH=H8>EAtOLH脡IHXHC(AH@Ht!LL$E1LLLHAƅAEAHD[]A\A]A^A_HHHHC(LLHPAƅuLQ 1ɺM1H53fL, 1ɺV1H5t3oxf.LLLHPAƅNL 1ɺf1H5*3%.1L jH53HC(LLHL$HPfL_H521E1@L9Hff.fAVE11AUI1ATIUSHHH6dH%(HD$1D$ jLL$}AYAZHHsHHxHt&LpMtH{HLIE HSH= HL11RH51LRAY^HHtJ>#tELGptj j jE,HLHHD$dH+%(jHD[]A\A]A^fDIE H=@t HI#V`L>IE(LHSLLE1PHA:AH8fDLT 1ɺH50B@H}@E,@3fD#EfDHLKE1D$ LXH5'0P1$_AX@ILV1ɺH5/1A,fLKL1ɺ7AWIAVAUIATUSHH8dH%(HD$(1BD$ D$D$SHH31jDD$LLL$~A[A\HH>HsHuHL`MH{HtLkIG HtHI#T$`XLd<,HKLLL$ MHLAą7HHtV>#tQLC5mtg guAC gE,tH}@E,|HLH l$ EAGH;1E1cHHAƅzH3HL$Ht LAąXLK1LH5-vIG HS fH= LL=c-H1LRL\-1AB_AXHHtU>#tPLBlt&f XfdfE,tH}@E,HL1yHa EH3HL$H Lt1ɺLL& ~TfL  1ɺH5Q,Q @LˠH=wtLHD$AHL$u HD$D5LeEuEeHD$H]IHT$HHD$Ly5H]@HfXL54 tL01f{Xf8&&D$4D$(10&T$ H5 LD$$#HD$@ H'HD$8HHD$HfLH L∅H$dH+%(H[]A\A]A^f.Lc1H5'DL| 1ɺXH5&vLihDL&mDD$4L5)3 HD$ D$(MB1H-n&L&H61L 1ɺ[HH5bl LyuMHWHD$8H^DLt 1ɺSH5%nH5z LuHHD$8HHD$HH5V LḦ́HD$8H>HD$HH1fD$(1D$ D$4_AWAVAUATUHSHH/IHvH;,H{!H{H{  H/IHL{LHLpLw/HLLHL{IELpHLpLA/HLLHJL;IEL;HLpL /HLLHL{IELHLpL.HLLHIEMl$HL[]A\A]A^A_@L 1H5#ID$LHE1UBLY 1"H5Q#Lf.IEL 1H5#LHAx@IEfDIEfDIEfDLd1 H5"AWAVAUATUSHhdH%(HD$X1HuHYHhHD$ LHHD$HD$(HD$ HH$L9IL-'"L/IGHI~Ht$0L|$HHD$8HHD$0HH|$ IHT$(HL$HPHT$(HHHD$(M$$L;$$M|$IG`H#C tHC(LHD$@HaStL"FL MIH5R!1KL|$ L;|$fDHT$XdH+%(Hh[]A\A]A^A_D=iZLL$@LL 1ɺUM$$L;$$)L|$ L;|$zHD$H$MoHIufHt[L`MtRI}Ht Lu=HC HtI#D$`t-IML $ILHLtD$uC@M?L;|$uL|$ L;|$I~L$>$f.1Lz :H5fL _H5L|$ L;|$isZH k $H5 H= fDAWAVAUATLUSH8HLydH%(HD$(1I9IL5XHCP;LHCHL $HD$tkH\$IHLHMtI@ HmL9toH]IHC`H#B tHB(HHD$HuIpu=WLHL1P1\HmZYL9uHT$(dH+%(uVH8[]A\A]A^A_@I}H Ht&IIWt"HIWHPIWHIG)UwPAWAVAUATIUSHHH4$dH%(H$HAHD$HB@HtHHt H9]HF7HD$f1ҾL)D$P)D$`D$pi1ҾJLD$iIL$@AH1HD$f@f@H<$L=6L6M9H$HHHD$(IH9M9- MNHL$ LMMQfHBHHHL1L1HH  IAIyH3FH3~H  H$1Ҿ9H8IL$@Hf-L=L14LfXHlL 1ɺMIL$@H{pHf8/HtH5 HT$; H L=LL$11LkALX CHH{p8DHBHD$fHD$1@H<$ DE1Ht%H56 WuL IL$@ttHft+11AHLrhI IL$@Hfn11A"HL9h*IL$@AHfH$HtdHC@HtHHt H9H-3HEVjHs@HA'1HtHHH@1H9t HH9uA9% Hs@HH HHH@H9 1@HH9u EHHHI1PHj L# HHD$@1fHH5A1U L^1_`f/tIOIWLH4$bt^LHLKAEL 1L誮1H5Y 7@L AWMAVIAUATMUHSHHdH%(H$HG@HV1fxX$f8&$@D0&A1A$1ҾHHU@Htf8&t& $$L$$H$L$tD$EML$ HL$1HHt1ҹLvH==?PH='P\5P$D$t DŽ$MH$LHHA$ALt$Ll$0D$#$uHLHtoHD$8$HL$0u HD$8=u==LLLHL l@ARH-LB1H٫Lu1ɺ1HA趫H$dH+%(HĸD[]A\A]A^A_f.D$H$ E1H|$XLMHL5SH;HD$PL1LDŽ$1Ht$PVHVAt; (<uD2<EathA(H1H虱AŃ1TvD?aD*LAFHE8L(L/H5vLH}HvuDŽ$A.DŽ$E1퉴$$E1H0vH=hLtH>MLHAE1H$+$LHt EWDAHL LLEH1ɺPLH51$AXAYg@1HTH$HH $H$11HD$0H\$8E1E1HD$0H\$@HHH\$@HAH0PQ1jecHD$XHD$(H ILl$ Ld$H9M7I9u%YfD$9IMI9t9IIHt$0LtD$tIGIMHBHII9uHD$0HD$(HL$ u HD$(D59Eu9 9LL{fL|$8I98Ht$Ht H}eH4$HVAfD#fDLY1ɺ>1L;8L1ɺmH5A@IwHT$0HgfD$E&1HRIH+H$L=ID$L-m H\$0O$57HD$8HD$0u77HH-HAE11DŽ$11HAWATj aH HL}$nAƄ$H-LHӥfD$E11ҾHʄ$L<1uH5AteDD8GLE1IL^G1!oǮ8L9LIQ1IL;>H5Ƥ,WS=HuAuE1D蝨H=HHtۀ8>ts1 HuA9uHGH1t@8t4LOI1PH LPH5= 1XZfGc1Hx A9t衭8aLAQLAP L PHB PHJ= P1貣DH V蜧G8萪IكARLO YLPH&j PH< P1\H Nff.UHSHH˨H1E1HLI HHQu" t5RՀ4wEIr1H[]fDuAHI9uDEtԅuо<{uEttDEAWAVAUATUSHH $HH $HxH|$HHHHt$HT$8HL$@dH%(H$h 1t$0MHD$HHE1L$`L$_1ېLHAH@BD=EDC>< IIuHAALHt$\L$ LL$QLL$L$ u|AH;L$v|$01HD$@sH0HD$8Ht$H0H$h dH+%(Hx []A\A]A^A_LcC ,L~e@Dl$4DAADH|$LITHTAGHDH9D$LHD$`DMHD$@1LHH|$HfDTLc؍HB ttHH=uܹA$`HcAHō;D$0_HD$AN4>E1M\$ 1Dl$$EMHl$(L+ IcA\`L9t"A\$I ttuˀ uL9uߐIcHt$L\$ DAD ` Hl$(MIcDD$ Dl$$螭DD$ DDH;D$D$4A܍C9D$0|$4DfDAdAHt$QATHt$fTHxI9H[]A\A]H1[]A\A]HLHL[]A\A]AWfAVAAUATU1SHxH$H$H|$(H$pH$Ht$0L$8>L$D$L$L$`HT$LL$LH\$ HD$dH%(H$h1LI@D$H)$`HD$XHD$PHHL$dE|LϦ1k;$`H5A%r0N*>H LVM2 x[H3$lH3$dH H|$Aă$tt0HLGA1j1H5p_AXL;$xt/H1H5NAAUL/1ۛY^H$H9$sH1A$L71H5葛XZEHD$$H$1ADHIM(HD$PPHD$`PHD$pPL$聼H IM@ADd$HHD$DH$HD jjjL$<H LL$XMO|$8H$HpΥHH H|$ ILLH$WHT$Ht$0ILL$H|$(HU1fH$`H=E1ƹHA1PL1H5ZAYAZ@HAL1PH5&1ǙA[[7f.$81H|$L4R&H$Hp萤HHH|$ ILLH$YH|$H5 IHDH$LHHHt?He1$LL$ LH5#˘A]A^$H踝L萧LXD$$؃Eu f.1H$hdH+%(Hx[]A\A]A^A_DEfMh1fDHHpA1AUL 1H޿A1ɺ $pLJH޿$1їXZLHt$`bHA1PL4 H޿1蝗A1ɺ$L!H޿$1sY$AL1ɺ1H޿K^$AL11H#_AXwM1ɺLZH5N1qHML1$XH5軖H賛ZY,@HD$PLL$D$LHpHD$裡LL$HH$HD$KT HT$LH9$Ll$L$LLL$(HT$H|$ LLL$(EH4$L|$DҿϦIAdD$ AA9t5jL1ɺULL$(H5'1ȕAZA[D$ 1D t$8HHH4$E1LH(PL}MbM'Mt L3IIHtHT$LH57 H}EGD$LM(LH1ɺPL1ATL%TAULL$8L|$XH tUH|$H|$H5 詡IHhH<$H衜L艣nL<H<$舙H耙t$ =$L$LLL$0H|$ D)HL$(HL$(LL$0HD$H|$ LLL$0ID$<+$F,H$HT$(LLHT$(LL$0DT$<HL1AURt$ AQAjH5 謓H0H<$蟘f.HMLZ1$QL 1ɺU1H5M1fDL1ɺo1H5|f.L1ɺm1H5LBf.L%,1ɺ1LL輒D$ ED$LH1ɺL(LPHP1AULL$8yD$XH 1|fHLQ1t$(t$ AQAj|fH1ɺt$L%hLL$(LaLH}D$0sAXAYE>31LLF 1ÑH<$L% 11L蝑HL11t$H5AQAjhH|$ H ZL1ɺ1L8L1ɺ1LpH}EtD$L1L%[E1LTPLL$1_LH5蹐H豕1,LF1ɺN1H5艐Mt$AL1jH5\[]LL$LL512ff.fAWAVAUATUSHH $HH|$HH$IHL$ T$XdH%(H$1H|$@HHF@H$H f HD$0t H HD$0H$fX HD$ H50. LHHD$AEmA$tLXHt$LKq Ht$11L2H$HID$@HD$(H)HD$(f HHD$8H)HD$ H$ HHHD$$8%= HD$(H$=`V HI\$HID$HHD$H9t&Ld$PIfAM6L9t$uLd$PID$@Hf$fX\ H$HD$HH8H\11AƅH$螕{H$H$HL{L1H$IH(HHDߐ9 ADDL$!A}#IcA^IUHHDP t$IUDP tH5 L 1HH$dH+%(j#H[]A\A]A^A_DIHh1fDHA譎I9BIL$ L$1fLLLL$H5)$ )$0)$@)$P)$)$)$)$莋D$HmetadataH9$ $ seqn<Hbackup_fH9$ Hmda_offsH9$ DHmda_sizeH9$ tHmda2_offH9$ Hmda2_sizH9$ THdevice_sH9$ Hdata_offH9$  $ pv_u$ mda_ H-ffD$(_offf$,se$.tHT$@1H5/ L3$5D$$o1H$H5us LL1ɺH-1HTMLH111L1ɺZ1HL1ɺ f$(il$$*eLLxHD$PLHxHHAA[ Et$A H$ f$Df$(et1H$H5- L跈L1ɺ1H$H5g- L$@H$f(^H$H$HD$(H HD$@HD$8Hh HD$(HD$0HD$@f$(se$*t1H$H5, LɇL1ɺDMS1H-uL}HfL1ɺDHAjLD$8HL$LHT$@Ht$P`A\A][f.f$$uie$&dW1Ҿ-LT$\o1HtLT$\lT$\H s $tLD1ɺ 1H{GH\$HFHILP [HD$H LAL'L xHD$xE1HDŽ$HDŽ$HDŽ$HDŽ$D$xPH$PH$PH$PHT$HHt$ H|$PL$sD$H E j1ۅLE1E11HD$xP$$t$Ht$(Ht$pH0 H$HjE1E11LHT$|R$Pt$Ht$(Ht$pnA$H0Et8T$tt09t,L51ɺ1H5 yL1L?1ɺ H5yECD=fBD:HD$tH|$011HDŽ$HDŽ$IHDŽ$I HDŽ$D$xPH$PH$PH$PHt$ L$L$q$H AH-H$H<$LH  HLABELONEϦDŽ$ H$H$HLVM2 001H$HD$0H$F1ɺH$A1L+xID$@H fX-n L1ɺ1Hw9$ D$LL$M¨ E LefDL$HL$0LHT$HHt$@H-1ɺ 1LHTw H5zLzLH$H$LHDŽ$HDŽ$pL {L$L$}fo$$fo$$$41L ; H$HHHH9LHH-11ɺ}LJHEvID$@Htf/d1H=?MHHMPL1r ~rY^ZHLD1H$1L$GrAYAZ HT$tE1E11RLHT$pR1$PjAVHt$poH0D$tAD$qHT$pE1E11RLHT$lR1$PjAVHt$p#H0uAD$p$L$D$H-M!EoCA LL$xH$MM9 HL1ɺP1H0qXZHML 1AVH1qIv|A[HXHu Ht$(H<$ILLHt$@IMLLLHuAA E1$  $H-A/L$H$M9MHL1ɺPHML1AVHoHtAYAZ1E1I 1H-!LHo1L1ɺrH5oD$E"1E1H-11ɺj LHKoID$@Htf/1H=EFMML$MMA-H$H-~HL9T$TL1ɺ{ H-AL1N Hm2MLH1m f/H<$HٺL~AEH1LNmL9HI L1H-j1Hmc H-@LHl*Lu1ɺ8 1HlD_nZA}#H-LN1 HulLmqXA| gEgAA|$pL$ML$MH-YH $HUHHIH9@Hp1H=rBH5XE1LnL1ɺ H-1H_iJUnH-11L H1iLjH$  $H-Vx H5#LTl@H$H$LL1.L$H"H5 HyuHHLHrpHZwHsLZmLRmL1ɺ 1H5,hH<$H$HDŽ$H-[~lL$I I1LQH1H%LL1M)MAVg^L_1ɺH1g+LD$pt"Ll$xMtL$H-MAPH-1ɺhAH1LAA gAYLAZ1ɺH1fvID$@HefWhL AcLM1ɺ1HfL+1ɺ1HrfrpH-L1ɺ HFf1H<$LDT$H-)]DT$IApL1ɺl H5Je]L$MuPH<$LDT$]MDT$Ifff.AWAVAUATUHSHHxdH%(HD$hHB@HtHHt H9L59LcpMtH5L^DD+LHE@Hf,HH}L$LjD"M1H$L1H5ZXZHD$hdH+%(!Hx[]A\A]A^A_MH5L]ujHH}L$LjD=MH$11L5,H5ZAYAZHE@Ll$ @HLHf#(DLH DHkp|$ EMLDA)AALHtEHLD$H5LT$D\$ $\LD$LT$H D\$ $HDHC@HtHHt H9^L H1AUH5{ Q1ASAWATARAVAPL0UXHPfL@Lr>Mt!LH5\HF LD=MH11ATLO(H55VXLcpA[A_M@DHL ּ L%{ ELLLD11WHC@H6HH*H9!LJ11LLL=qWLspH V LDMt!LH5ɜZH + LDH1LAW1MLjGWDHYLH_LH9BIM)HH}$LjDýIXZML$HH}L$jLD}LL$1LH$L)1wVA[A^AD+ E4LH L LELr11VDHH}D$LjD踼AX1AZILKL1>UD11BLRLU11ELPCLpUD11LEDLLU|$ EL MEL]x 11LULƹ 11FLUHE@H2f)$)HHL-H9fDHPLLHBPHrH1Lh1xTHE LLDH H$Dɉ1Ƀ$1ETHmXZH9t`DMEH1LMDȃP1THE Y^HPLa1ɺ1LSHmH9uL 1ɺ1LSL i@L<1ɺH5v S@L%nv L 1ɺLVSOL1ɺ71L3SfDMLR1L,1SAL1L@1R'II)Hf.LJL1ɺ1LR\fAVAUATUHH(dH%(HD$1HG@AIHfH@1HH$HD$IHHE11DID$H3LHPAAT sDL$]AŋD$+D$Ls= $H5 11QXZLH!HD$dH+%(H(D]A\A]A^fD10LE1@H5A%QF1E1LJH5rAPbfDL 1TH5=AP-$[@AWfL=>AVIAUAATUHSHXdH%(HD$H1HG@)D$)D$ )D$0Htqf)X$}L f L=11ɺLfLPHE@Htfx"tf%f1HIHHD$1LDID$E1E1HHi?PATpAXZL$@HH}$DjLHt$0JD\$ $$H}HD$DLD\$Ht$(H+t$0Ht$($$H}HDLDt$$D+t$ 軵LT$D\$L=/L$LG1ASSAVPDL$D1NH0LH,HD$HdH+%(HXD[]A\A]A^A_fD=LL119NLA1H5ANuL1L AM>DL CL=af|Xff.@HHG@Hf#tIf#uf)L}D1H5)EMHfu f!tLu}R빐f(ufufX*ufuf*ufuf#tf)u[f,u=fDH1E1E1PjmZYRff,H.Lj\ L.Wff.@AWAVAUIATIULSHHHFPHL$LLQI|$LxLHLLHYIEL{HLPI|$LhL赮Ht`LLHYoHHD$HEoKMoS U o[0]0HC@HE@H[]A\A]A^A_HD$H1LfZH50KH1[]A\A]A^A_IEff.ATUSHYHLb@C@HHL2HHt:LC HK0HS(HvAEt C8[]A\MtSI$HtJL9tELH=L H511NJC8[]A\DL 1LG H5J[]A\f.ATH1AZtDA\ALi11ɺRH5hIDA\fDUSHHHt.Ho8HH:u"9hLrUHDmH9\H[]fDH@L!H5LHH1IH1[]A1'LH5HH1[]LKHLH5vH1^AWAVAUATUSHHhH|$H4$dH%(H$XHAHD$HB@HtHHt H9#L%H<$wLE HHD$LxHxI=HCHLT$0HBHH$HmH;l$HuLMMpL%LJ1PL)=1LLӹ =HD$@<H$L9tKH|$@HH H9u9AtHpH9rHL9uH1H9tHH$H@HmH;l$(H$HH;D$(D$XD$HD$Lt$xIMnL9l$1MtI}HLFD$HIIHL$0H9WH@H@ @HD$xHH9H HH9HsLtAEa@LL$8HŅHMHD$xLLHD$@pLT$PD$tZLT$PHD$hMIBHP@HHHH9H@HL$LT$PLG!H5 LIHP11AuH:_MAXL;d$0LT$PL$ML$MAD$LE1LLu; fAE;D$L$ DL<@I$IL8uH@HJHpHI@H9N@uHJ HH9tD$IL@HH;Z  I$HDDpAD$PkE|CŃA9rA9wIt$AFtED$LA9~A9vLHL$`D)HT$PAAt$ HT$PHL$`hL${1ɺ!H5 i9L{1ɺ!1H5| H9L%11LLz$9Lz11L9fH2HBHFH09HHH9cTM.HhM9fH\$0LIfDHI9$HsLtL<LIL%1Lb8Ly1ɺ1LE8 Ly1ɺ-1L81LL7HHL$0HHH9gSHvIUHL$0FHRHH@`H$HD$8H\$0HK`AH$LHHD$FHD$@H( HD$@H $HLHL$H@L9l$HH\$ HKfAoEAoMHIu Hp H}HuH(HpHuHMmHEL9(L誙HuLA H5 6L%51ɺk1LxLo6L x1ɺVL%LwL76 Lw1ɺ4H56M6L;t$(D$HD$Mt]HD$DXpE HD$H@@H=f8/H|$ LD$@H|$Ex H|$11IH8 HD$H@PHHHL$8H9{MHL$8LaL9d$GM$I$HL$@I9)MMAT$LE1MuAA9DH @IHHȃ8uH|$H;xuIwEgPhFAw E<$EtHL$0LMDl$(IEAf.II9t%C 9wS$ 9HI9uI~D$$H-^ ߰HLt$I1VH4XZLu1ɺ1H3LL%u1L3V9D9r#A)(LDl$(MPLIf$I~AD>S$LDHHH911HH9uH "HHhLH}H=uMM$$L;d$@HD$MH@PHL$8H9HH|$8H9Hl$AHL$0ID4$Dd$(H|>I~H2USH- IATt$LҘ1VHO2H ED)LHT$`H$AAt$ DD$P~DD$PHT$`H$@Ls1ɺ!H5 1wl$H\$ L%tLgs1ɺCL11MLpH571JHL%Cb@LH L N LDHLP101AXAYH-J 1ɺ1LrH1D$LnLL0KL%YLL0sL%>1ɺx1L(rLx0L%L1|LL0LhV^LړHL%MLLƄ$O/Lq1ɺ1L/gDT$XL%fEH$LL L1/"H|$LD$@H|$EyIIM$$L9d$0MML$L$IH9l$0AE1L$L|$hLl$PLl$EML$Lt$ EL1ۅuD;]LMH@HHЃ8uH@HPHz@IT$HJ@H9uML$ D@IL9tpPA9AA98DUPHHHQH9HH@H9H,H9#LOD\$`HARAPL`P1R!VH5 -D$H0E=H@HHHPHJRIEPH5c T$hHL$`H8菠HL$`T$hHIHEHI@HxHH@PLEPtHHHH9LHLT$`11WAPLnVH5D Rk!-MPHAUpUA E1LjjjjQjjjH$KHPHH1HHD$`;H|$`IIHIE1IUPO HGIH8EPAEpHIEhLIHm!T9]L@M[AjHI9D@Lm1ɺe!1H5# Ll$Ll$P+E U$HHL$ LZH5 LIHR"P1AuH+H UDII9tL;xHI9uHD$Hx[HI>LxYIVL0HPIVHIFdL Ll1ɺx!H5= Ll$Ll$P+L HLl1ɺh!1H5 Ll$Ll$P*LSl1ɺt!1H5ʘ Ll$Ll$P*]L%LLb*H (IHDL%Lk1ɺL%*L0 H5 )fAHmH9l$0L$Ll$PL$HD$L$t;HpIM`@L]HL$HLeH5:DIpP11D+$v)[]_LHH|$0H5# h0IHH! HD$P[Ht$`L%LƄ$IL(Lj1ɺ!H5 Ll$Ll$P(D$XHjHjI{ML5L%'1Lo(L=I11LuH54(D$XLi1ɺ1H5: (L%L,L'u L1L'L%ELL'MLOH(fH|$HvL=LhI11H5ɣ'D$XH|$H!L衣=RL֋IPH P11H5k&XZD$8D$X1L%ALъL&"1Li H5 b&HD$LT$P1H5t L!LHHHģP1AuH"&Y^LT$PLL$0Lvfa0H Z $H51kH=Bk(LL$0L%eL̢L%AWIAVAUATUSHhH|$Ht$(dH%(HD$X1H9 _HD$@D$<HD$HD$HHD$@HG@Ht.fxXt'HHH9@H8 1A LD$u!L^b1ɺ" 1H5Վ  IUPHD$HHHL$H9MAwp1LH\$@Hl$H;\$u5HH9(H{Hg`=uLa1ɺC H5?  HMOHLP-LMHWL  PVH5 AwHQAF P1H0HMOHLh H5 QP1{H La1ɺ H5 SL H5[ ,} |T%JD$<L襛LhIH51oH1LbLc H5 L`1ɺ< 1H5 \(ff.fAWAVAUATUSHHHYHt$dH%(HD$81HLbpC HIMtH57cLU!eHE@E1HtD/I~@LHD$0HtHHt H9KIF`L-X@`HHt$0D\$LT$Z4LT$D\$Ht$0L=t Mt`I9L=_ Eu I9I9VML1ARL1LT$ AYAZLT$LT$0LHML1VL1HL$@_L AXL9ML9AI~`LHT$D$HGP0HD$Ht)HHH5a11M麡LtL1MH5faLD$LH`H5.aLLt$H|$^H|$\M麵L=LXt11C@Hp@MfpLhIF`@`Mt1L؄H5A L\1ɺ21H5wHT$8dH+%(] HH[]A\A]A^A_fDML[: {H5 fD\$HH}L= LT$$LjD>1LMH$L+1:A[XD\$Ht$0LT$ELT$HH}$jLDɀHt$($H}HD$ $DL荀AYAZLHL$HH=11HPLH5P1ATRnt$8 H0+MfpMgH5,PLJKHD$H$HxL@t$IjDnqIN`AXH`bAYHtHQ(=כKAHLPHn H5RP1Q1t$82 H0YLL$=Ln :11H5 $MH5)OLG ACAH1ɺ_H5Yn LVH5;P1t$( H AAA+HHHD$DLHxшT$$AHjpH|$IA$@t$AHHH$LDoZYH `IIF`HtHH(MnpMt+LHL$H5M HL$H:m LDCATAAW=ЙL1vQH51AUP1t$8AH0hLI1ɺNH5DHjnH\$IAH{$L@t$A$DHnI^p^I_Ht!HߺH5L HCl HDATA麉AU=טLuH5S11t$(PH wACAH1ɺcATLvH5P1t$(H 5HIHHHL1TH5r44fDAWAVAUATUSHH $HL-1ɺLt$AdH%(H$1V1LBAYH=- AZ HeHfDHHH<z.tL$E1HLLHHRLLH^L L- Lt$0:LLHD$,LD$(_AXLE1HT$Ht$\9\$WD$ 9D$I1ɿ1ML"LIL t<8t0, 1LMPH! PLgG1Y^|$ L.cL6vHnHHfHu,H$dH+%(uVHĸ[]A\A]A^A_C8 1LPH L + PLF1_XZfDAWAVAUATUSHH $HdH%(H$1Hk HIHL= E1L5~LHHz.tLHHHHL9\1RIٹH$Hl_AXt@ 8t I1PLELAW1aYL^HHgL`u,H$dH+%(uVH[]A\A]A^A_ 8 #I1PHp LCEPH5}}1XZ> ff.AUATUSHLaHB`tH[]A\A]@HHHHtHt$Ht$uL-}1I1L6LDE1H޺H謊uHu@HLoSA1LXZA$;IٹLLDAWAVAUATUSHH $HfHt$dH%(H$1H(D$pD$LD$H)D$P)D$`HHHHD$0H9H$@ILl$PHHD$H$L$H$HD$HHD$ HD$LHD$(fLpH;OHSHHPHSHHCIHAL98LHt$a11AULoH5!{}XHmZH;l$0 HELHL ' oLXA)MoP1HLA)UAU H|$1D$\HH|$D$XH_AXLLt$L$HT$ Ht$(LV$@tH|$L9 AD$Ht$LLHH H 1H%H ƀ$HE$+SIHHHL9H@HD$HEH5' H@HHHD$8uH|$H5 .IaHL@1ɺ]1H5yH=w(E1Htb5H_(H$dH+%(;HD[]A\A]A^A_HApHD$&L )p@Al$H\$LAu>AULlt$AUSHH5x1 H +HALzlAUt$UfH$@LHmuƄ$At$8Iك=t$11H5(xLzlXxY^l$H\$LAt$AٹLgkt$ @AUUL>1ɺ0H5w<}X=dHA1t$@L lH5}w1t$ SH 4HLkt$A1@t$(H5:wAUUSH0H $H5AH=AAWAVAUIATAUHSHdH%(H$1HG@D$DHD!L|$P1ҾL|$XDt$ L|$PÅELMk1ɺH5Vv1AH$dH+%(HĨD[]A\A]A^A_fL|$P1ҾL|$XL|$P D$HE@HSfh t H(1gDd$H=^" ayL5y" LJyH=# 6yFD\$ELd$`H= " D$LLd$hLd$`LH=" H}Ht1ɿXHD$HLj1 H$Ht$11LjfHLf;1ɺmIHu<fHXH|$`0HT$hL HPHT$hHHD$hLHEHHH}C\HuIEHth I}8L0L:1ɺrHt$1AafDHE@H3fh ft(HHtH5tiCc3 H$H\$pD$HHH\$xH\$pHD$ H$H$Xc Lؔ H5rA3fDtDL$0L~h1H5rA9fD6L- 11LvL * u+1u1ɺLL8FHI1ɺLL8fhtfH=vA4JHt$L81ɺaALg1ɺD=ALBf11H5qbDL71ɺH5t 9@L71ɺH5L Z@L71ɺH5$ @IEHth I}LHL$LMLHDT$AEL9|$P1HaHD$HHL$Ld$PHD$DHAI$M9HoHD$CD=Ht$MLt11HIL9EHIt$HeTtQMd$uN=5HA1ATHt$Li1^_Ml$tz=Ht$ML4t1ɺhMl$Ld$PM4$M9utIH@ H@XHt<11HЅu/H-!I1WHLDXID=uEudHU@LD$PE1HL$HHtE1f"A1Ht$HhHT$hdH+%(Hx[]A\A]A^A_DD5nEHH=n:DnE%DNuEYeH}Hw.IHM$HD$@LLD$uH}LxLE.HHt$LHLM$HD$ LLD$6H}LxL.HHHt$L Ht$1HHD$'HD$HtHE@I\$4Ld$8Hof)tHLp)LH}L`L-H-LLHHD$(HE@HfD$0D$XE4@1HvIHHD$ HT$E1E1ID$1ɾHHPAT9^L_HxDD$`EDL$XEH5 HHE@HE1LD$PHL$Hf"ALyfDLBa1H5FdRf.fDH-EL 1ɺ.Hf1HtIHzHD$ HT$1E1ID$H/AHPAT XLZH\wL$`|$\1L? 1ɺH57ED$\sHD$ vL 5 fHD${L4 L@jf.LD$PHL$HE1hfDL(Hpkf1Lz 1ɺH5rDD1LJ 1ɺH5BD}DLy^ f.HD$(LGff.AWAVAUATUSHH $HXH-q H|HLH|$Ll$@IHLdH%(H$H1J jL1ŅL5M1ATLAM?_AXI9uf.y1H$HdH+%(QHX[]A\A]A^A_ATLAUAL>1AdY^DHAt7H1ISL .H5?A\1A]T{S.UAL 1H5?[1]f{HM1ɋL"E5H5L?P1AZ1A[D;8EM1PHO_LPL1[XZff.@AVfAUATLUSH0HdH%(HD$(1D$ )$)D$I9tIIIH@HAEL9t-HCHo)MoP)U&.uHAL9uHD$(dH+%(u H0[]A\A]A^@AWAVAUATUSHH $HfLH|$ Ht$dH%(H$x1HD$`H)D$@HD$)D$PI9Hl$@L==L$psHX-HعLHHUL N LL41L$L$HعLD$LHLD$HHL_AXLMHT$8Ht$Aٽ>@Ll1ɺH5=A諽I11I1ɺff.fIй1ff.fIйf.HHzE1HAt0VE11E1j1D3[AXZEtHHzf1Lz1ɺH5<迼HDAUATUHSHHH9t4L- L%r LK(M1ɺrL1cHH9uH[]A\A]ff.AUATUH@SHH@H9t4L- L% LKM1ɺ{L1HH9uH[]A\A]ff.IHHց v@EEtEH ~u:LH.fDtS@H LHEEt H >tt H ?uH fEEHzP11MjE1ZYHA1GLS>H5:ºHLLHLzf.EEtH.tEEtHtZtHGH;DEEtHtH Hdff.@H!USHH>tVDH5 HyAEt H5L! H]u)1H[]D@fH5h( H!t[H5* HtZH5 Ht'H5 HuTu/v1@H[]ÃETJ1ILt<:H58蛸AWAVAUATUHoHSHH_HLD$H9AAI1E1@AtMHH9tuf@-tft HD2t}1f@-tH-tD tV~AuIMtHcHHHMH9uH|$HtL/H[]A\A]A^A_1T1L:1ɺH57H1[]A\A]A^A_E1fAWAVAUATUHSHIt|HLxLpL5IH@C|/_LDMH]1ҹ LH%HBD-A|$H](H[]A\A]A^A_fHkP H u=E _uAąHD$= = =`=T H\$81ҾHPHL$1HA0HC@H fx. H|$8HL$HA8fH\$; HD$8fHDŽ$)D$`H@@)D$p)$HfX*H=84?eHD$PHHD$ HD$H|$PHp8H~ HHD$X衚L1ɺuHD$`H HD$8D$,HHHHHHD$0HL$H9uN @1<#6HD$|$,D$,HD$HHD$H9D$0HD$fp*tft3HHD$8D$, HD$fp*HD$HH*H<+<-?HD$H|$,@@1ҋL$, u~ ,HcD$,HL$HHHHH|$GHtf.HH9H:@uHD$@u\H\$81ҾH`HL$1HA0HC@H fx. H|$8+HL$HA8 D@H\$81ҾHHL$1HA0HC@Hn fx.` H|$8ƇHL$HA8Lt$81ҾgL蓇H\$1LhHC0{1ҾiLHC8hHCHO=DH\$81ҾH@HL$1HA0HC@H fx. H|$8  HL$HA8DH|$81ҾHC@fDHD$8HHHD$0HD$8Ld$Ll$0HXHA<$I9Hl$H1HI9tf*tftHsA<$uu1@ +~uf*Hx*HcHHHHLxI9u1҉@HL$HH|$8E1WAą HD$8HX@HftHHL$HHA0Aft HD$H@ftf*u HD$H@ ft HD$H@f( H H*HL$HAL.\$1~L1ɺ1H5 .H$dH+%( HĨD[]A\A]A^A_LX1ɺO1H5-蛭HD$HH|$PH H.x HHD$X返HD$pHH\$HL|$XLt$PHLL苔H$HtmHpLLgHD$xHtLHLLFH$Ht(H`LL"H$HL]1ɺrH-,1H蝬H|$PL/1ɺHH1E1sftHD$H@@$ft HD$H@(ft HD$H@,A2f.HT$XH|$PLHD$@HtiHcD$,uOH|`Ht$@\Hf.HfD$,HL$@HL`HD$@HHL$ H9HcD$,LlHD`ILl$HHD$DHD$ LLpGIHD$HhH9L`DLHLzuL1;_HLLLZuM1A?_ILHLtHmH9l$t"L}LL.uHUHEHBHHD$ HHD$ H9D$@;1I1H-*L+HRH|$P H-V*1ɺ1LHL1ɺL1HD$HL$8Hy$Ht$`EHL$HA8HH|$P= H\$81ҾH贀HL$1HA0HC@Hnfx.`H|$8HL$HA8aH\$81Ҿ H]HL$1HA0HC@Hfx.H|$8 (HL$HA8 f.Ly-?H5)1E1٨H\$HLt$81ҾǃL1ҾLHHHH %AąyH\$HLt$81Ҿǃ8Lg1ҾLHhQHH8HpAąH\$HLt$81Ҿǃ@L 1ҾLH~HHHqAąjH\$HLt$81ҾǃL~1ҾLH~HHHAą6H\$HLt$81Ҿǃ(LY~1ҾLHXC~HH(H`AąL1ɺ71H5'@HD$H|$PHp8Hq HHD$XL]1ɺkHD$hHpH-&H葦H|$P H|$8 }HL$HA8eH|$8f}HL$HA8HH|$8I}HL$HA8+Ht$pABHL$HH HtH\$8H$H{BLt$HIHtXH{Ht$xAIpHt>H{H$AIHt!H{H$AI`HL-1ɺL1ɺ41H5%]pH|$8Y|HL$HA8;H|$8 <|HL$HA8H|$8|HL$HA8L1ɺ31H5%Lw1ɺHt$h@HL$LPHA81HeH-$L,)HtL 1ɺL1ɺ51H5_$;NL1ɺ61H59$(L1ɺXhAW1ҾAVAUATUSHHdH%(H$x1zHHC@HtftHH1ҾfIyOLI1HHC@HfX D$@HtH5HŭmD$@E1AAD|$DlBH=$hBTIHs(HHHfH@ @LD8LxLpLxLxHf@@ @0HUHH|$LxHBHE ЈEL$LHDŽ$LHL1j$D$DPD$HPD$LPD$HPD$XPDL$\LD$pH$H$ H@IHjH$HHLxBL$L谦H;LhLHLLH芯HBHJHpBAHBHJHBHJHBHJHBHJHBHJHBHxBHqJH$xdH+%(yHĈD[]A\A]A^A_DAL=f HL8LM HL^MD$@D$DDAN1ҾfHnAąHtH5HªpD$@E1fDMD$@D$DDADL- L[%L۟HI$HtH86I$HttNI<$LE1萤L$1H5)s c1E1L$H5`<6L-CL1ɺ LHAątoE1L%1H5r LC[fDL$1H5Yr ƐL,1ɺ&1LsmfDL-{LZ1LA.@IH-H1E1LH 1HL ARL L"AWٝXZfLl1ɺ&1L賝fDL-LB#1LHǃBvܧOATUSHdH%(HD$1HxB1IH7HxBH4$1HHE@HM@H9tDPPHH9uH]PLePM(I9u_HpHt HSHvoHS8C0Ht'HBLExHHHu@H@HHn'PPHI9HHu@L1ɺAH5o 01Lr"9H50 HT$dH+%(upH[]A\fDڐL|1ɺ6H5f.L1H5莛fH11荤H@AWAVAUL-qATUHH5SHHtD}AHCEHDE1D3EtrEIHINj<9A_thELH/t[HD[]A\A]A^A_fHD3EuE1EAD}HHՐD}HDD}AHE1AWIAVMAUIATUHպ SHHH50@ HdH%(HD$1oH5@ HS; H5@ H7H5? HSH5? HH5? H}fA}u7DeAa(CP@HS(H5 L1虛AăL1ɺL% 1LLI1E1L ̘HD$dH+%(dHD[]A\A]A^A_fDHH5? LL*1ɺAăl1H;dL TKPfDHT$H50 LD$褚L1ɺAăD$==L1ɺHSH5%? L=AăKPHSH5> L L91ɺAă{1H{dLbKPAHSH5> L譙AăKP\H5 H|AąCP HS,H5؂ L1RAăLr1ɺL\1ɺDLD1ɺDHS H5= LAătL1ɺZfKPH5 H謙H5< H萙 H5Ht,H5i< HXKH{@Io1E1LdH5 諕fDL1H5 |KP L1H5W CrKP@iHS0H5 L蒗AătAL1ɺHS4H5 LdAătNL1ɺKPHS8H5 L-Aă%LM1ɺKQHSuH@X@cfDfDAWIAVAUMATI1UHSHcHLD$A$2HCu HHE@Hf/1ҾHFL w Lu H5 ҃HD$XHG LE11xHE@H9DHD$PAbH1AeH53 Aƅ1AbHAeH5 LtHE@Hf8##HCHAu @AEH$H}AujLDL)1H5 IX1ZwHE@HL$XHfx\HL$PL tCL nt7L t+L6a 1H5}C wL L 1ɺ1H5 vG@A $7Ll1ɺ1H5é vHD[]A\A]A^A_DAEHtKftAfC1E1LH5` Lvf.1IfHAcH\$hH5yHL1ɺHH5H@ H@XH11HAƅrLK(1H- LvZ HuL%11HluL1ɺH5U 1E1HH2MtLxfA uLj1ɺ1H5 kE1f.HH[HxHuH(D[]A\A]A^A_fMLH$H I|$H5 uD$H$L(McLd$1MeH52LIE Ht DE~L q1LL H5ܝ E1jH$Hx8-fDLL1ɺ1H5 LE1jHH@UH9tEMmM3ALd$LfLܫ1ɺH50 !jo@H5HLIE HDEH@U H9rE gH$1E1Mt$@MtffA8t(1ҾL D8D$ADՈE4AfAXt(1Ҿ!L D8D$ADՈE5AՋE=v E1HHD$AHtD(H<$KL ;H5Lt2IE H8H@UH9_ETH5@L[IE H0H@UH9E 1ɺeE1LH5] Nh.1ɺLL֩H56 'huH$1E1PL 0L  H5 LtAIE HttL f LE1H@UH9IE>L5FLLBtIE HttML5LLt)IE Htك8uH@U$H9E$L5LLt)IE Ht8uWH@U(H9E(H5`LtAIE Ht,8u'H@U,H9bE,WL L H5FLFt)IE Htg8ubH@UH9EL5LLt=IE H8H@U0H9E0L ó'L5GLLt6IE Ht8kH@U4H9sHE4dHLHhAƅt5IE HHtr8umH@U5H9%HE5HbLHts|$HGt8IE Ht 8uH@U H9E I8HIL^ nH5 1Ld.H LHt7|$H tIE Ht8uH@UH9KE@HLHDtC|$H^IE HB89H@UH9EHLHtD|$HIE H8uvH@U6H9HE6HİLHtX|$HIE Ht18u,H@U7H9FHE77L L bH5L&t=|$@IE H8HpH}8!AƅtGH5LAƅtRML 11JH5 bL1ɺD1H5 LbML NL Ff.AWAVIAUIATIUSH_HHHwHdH%(H$1H\$Ht$H9Ht$fpuuH|$HH\$H;\$u݅AEPA<-IEI9EL 1[H5 aE1fHHHt1DIfHT$p1HL$0LD$,LH$H5 HL$)D$p)$)$)$)D$0)D$@)D$P)D$`cH$HL$u9MLL\$,HA4fI9cM#1L\ H5 `E1H$dH+%(HD[]A\A]A^A_f.1ɺ*$L=H5 `D$1ҾFL5HGHXHu9fH[H*L{MtH{ uH;H5; j$uHl$0NfDu}HHH H1@聹Ix\MHLLtwMMxf)E)E)E )E0IG uHHH" H1@ MO1L H5 w_D$L 1ɺTH5^ O_E1aifAWHOHAVAUATUSHHt$dH%(H$HGHHL$H$H9t*Ijournal_H$f(uH$HH$H;D$uH$H(Ht1HAcI9sfDIL|$pLl$01fLD$,LLH5̸ L)D$p)$)$)$)D$0)D$@)D$P)D$``!Dt$,L9d$pHwatermarHT$pH3D$xL1H u$kOHcommit_tH9D$pHlush_intH3D$xHbitmap_fH3T$pH u$erva>Hallow_diH9D$pDHAbI9D|$xsectIf|$|or<|$~s1HD$H5:I LHP1_MHD$@AD$A AA=UHD$H<ff|$xim |$zeHD$H5H LHP(1>_La1ɺUDHD$H5H LHP$1_u!HD$x$dRHD$H<@L 1ɺfH-c 1HJ\ML H1'\1L1ɺH \1H$dH+%(H[]A\A]A^A_|$xscar)f|$|dsHD$H5G LHP81^1HD$x8;HD$H<D$lHD$H5JG LHP,1]L1ɺ@L̜1ɺD1MLd H5 Z1L1ɺqwHD$H<(fH-Í 1uHL ZL511vH|Z-HD$H< L1ɺfDL1ɺdAWHGHAVAUATUSH8H_HHt$(HL$DD$$HD$H9IcHLL,@IL,$HMPHAH@@`|$$HL$JL^HL$LhHyL腼HLLHgHIHEPLHx>H|$t,HD$LLH@`H@Hx>A…DHH;\$:H$HDfx(tL8MtH|$(Ht1҃|$$LHH|$t|$$jHD$LM.M9uIEMM9hIIvLcuI6IFHFH0DLHHD$MuL9uFf.IML;t$t/IIuLbuIEIuMHFH0IL;t$uH|$:HH;\$f.A`LHuHL WH5 1WXL9Z1ɺH5 1{WE1H8D[]A\A]A^A_fDHD$H@@HtHHt H9HD$HMPH-, 1L| HWYL^1ɺH1VD$gHEPuHMLZ ^fHEPuHML cL 1H5z fVE1HB$L11H5E 1VD$AUATUSHH*dH%(HD$1Ht`IIH/H^Ht9HHLHHM,$Mt|LH1`u}H,$H+H莮u*HT$dH+%(H[]A\A]fD1ILR H5] IU1DI$f.H1IAUL H5 UX1Zef.1L1ɺH5 T133_ATSHHt)H;Ht \AątEAHD[A\@AL11ɺH5p \THD[A\ÐL1ɺ1H5C /Tff.fATUH SHHIHfH@@HS@H(1Ht 1f(-AD$AD$ HtjHHBHHBHHBH HBHHBHHBL[]A\@HpBuHFuH{LE1͐L9 1OH5 Rf.AVIAUAATUSHHHdH%(HD$1詵HH@I1DfHHAą~HH ( Dm ASH} L PHH5{Nt$QH HEHt\InAHD$dH+%(HD[]A\A]A^fDL1ɺx1H5 QDH{HE1Le11}H5 Qys1E1L H5 yQJ[ff.@HATUHSHFHHt@L Mt8I$HtH8裳I$HtI<$舳LVHBHBHBHBHBLBH5OH PL1H=2HCHDuH}tfEE[]A\HpBtt`LxBHǃpBMtI$HtH8IJI$HtI<$該L!UHǃxBuL1ɺH5 O|ff.AWIAVAUIATUHSHLvH $H|$ OHt$hLD$A^ MN LD$dH%(H$1HAFHL$ ڃ@1T$hD$lLH+IHEN@LpA@6AA1E1La H5 NA^ LHIGq+ALa11H5 NH$dH+%(SHĨD[]A\A]A^A_EN L$T$AAL aH5O 1A#N6fDAN DL$HHDD$H$+A D$T$EN MrA@AL rfDA^ L@11H5 E1MHt$IH踍AxtL@wutHt$LLHAIL|uxILLHcAILLHCrA…tLvttLvaLvU…tL0|ptL=|]L{QLZ 1pH5i A?LRVDAWAVAUATUSHL.H|$Ht$IMdH%(H$1H $L9D$II,$I9MuI1fIwL4VM?M9uL}1LoLt$ L)L$ oP)T$0xPLP։T$T$H=|LrHHH@Ht~HH|$<&uiH}Ht$P@MHUHEHBHIM9tBI}LIHuSUuHEfD$@)D$ )D$0H'IM9uMM 1L, H5} sJHD$Hw 'H@ H HHHfHHHHJHHKHQfHH9fxuL 1 H5| IIUIED$HBHL,$IEL;l$tqH$LL1ɺ H5| I@L 1 H5x| dIxD$H$dH+%(uD$HĨ[]A\A]A^A_SfAWAVIAUMATUSHHH|$0Ht$ H H$dH%(H$1HL$D$<H9H$L0ILt$HL$L9LcLH\$(MHuLIHSt'I$MLL;$$HuHIRuHuHEHFH0I?IGL}HEIGL(MoH\$HH;\$ tHD$NfDH$dH+%(Hĸ[]A\A]A^A_H\$(HD$0H@ @L$<4LKL 1ɺ 1H5z GHl$0 H}lIHIH@LsLlLH}LhL<HLLHEUI?ID$IGM<$ID$IGL MgfLKAII1f.<-tqHcD4@HuD$< H|$@1葵D$<H$L0ILt$HD$Ld$`L;4$Hl$Ll$I~@L6H{LPHl$HMN1AT L] H5 y  FIIFHBHI?XZIGHT$M>MnIFIGLHIWJL`HD$0LHx覨HHtLLHSHHKm@IELML;,$I @ID$;D$<H $H5H=GOff.AWIAVAUL-x ATI1ULSLLX HH$H$ L$DL$4HD$@H$H$dH%(H$HHD$hHHD$`HHD$XHHD$pH HD$xHHD$PHG @D$1=DH$0AHD$8H$8H$0H$ HD$H$(H$ H$L$L$HD$(H$H$MLHIHXH蝦IHtHLHQIIHt$L( HD$H9$ HDd$E:H5c L談D$4 uLLLȄ1ɺC  1ɺN L1L B1LL$} Hl$H9$ DŽ$L9$L$4y H|$(LtHD$@HD$HH HD$Hht HxHHDŽ$DŽ$H$HDŽ$H$HDŽ$H$HH$HH$Hc]H$HD$H9$  H$H;D$(DŽ$DŽ$HD$ MH$@HU 1HL$ HHI1t$(L9  LH1=AAZA[$t1H$HLo5 HLHLH$P\$DD$L$PAHHD$(^_LH$PH$PLD$ H$$艰AXAYH$Hta}#t[Lۭmt{ u@ H$HtP,tHx@P,K9HLxeH$v$ $$4D$EsH$ L|$L9IH$0HH;D$8 Htb}#t\L=t u75 HL$HtA,tHy@A,h8HLdH|$u $HHHD$HHD$H;D$(#7$[DŽ$HD$DŽ$HhL`HLXHtH$Ƅ$@HtH5HAH$@HD$ Mt@HLaHLfDHD$8H9$01fDHt H;; H$EALt$ D$$HDHgf.L1L胫/HIFHzM:L1 L1w=$HH9[L3A>@uA~MfL3LCBILpLIHtLLHKIIHt$8Li"uLe 1LA<1Lk~1ɺ' LM M6I9t0IvH ?uH$L$L$ M$$L;d$8uH$L$HD$L) LL14HD$HH@@X1ɺ- LLu3:]Hx@P,,m:Uc=1L8u1ɺ9 LA{3HD$@HD$HHLl1ɺ~ LLtA331L 1ɺb LA 3HD$@HD$HRD$11ɺ9 LLvt29*=f.AWAVAUIATIUSHHHQ0Ht$Lt$xHdH%(H$HFHq8HD$$jAE,qHME0LPAE(PAE$PAEPAE PEMߝH@HjHHD$T$xMHL$tLD$pHHhI}89iAE@;D$4L$x]>w$HD@@>{1E1L H5 b1fH$dH+%(BHĨD[]A\A]A^A_@I$pBHS(HtHGsD$4.f4vb]AEpHD$L=~uLpf.L1ɺL&I A?uA?Iu8HD$pT$t@DžF H >`@6 HT$LqALq1ɺVH50 A 0HHtH8tHHtH}ZH4HD$H|$Hx_LTq1ɺL1H5 A/L$q1ɺRH5 Ac/VfDA1ҾLAL{@MAL$DL$8f<,u@AGI<,tLAGIt<,uLH) HL$|HLD$HT$(Ht$ )LD$HT$(Ht$ AH1L=A VLi LpYL p^1ɺL1PLa 1H5P ,.@AU@th;tcD$4I$pBHytLo1ɺH5 -DDL$8!fDHfDHE@HU@H9t,$t$|fDHH9t9H,u9puH(AS1H)@H L H50 -@DL$8L^IU8DD$tDL$pHHt$LpAuH)LM}EuHD$ H"HD$@HHD$HHHD$PHHD$8HHD$(H$HD$H$H$a+E AFH\$hALl$`IDLl$Hl$XH@>Z0 I$I7LqHH1HHt H;Xh4H=lHH9ugHH NH9MH;Xu.H_H$HXGH$HL$HPHHH$f.II9Hl$XLl$`H\$hL$HD$I9Hl$HLl$XLl$H\$`kDIG1HHHt3IwL8I_1HHt H;XhM?I9tLl12H5l<*gIU8HHHL$LNAIu8H9HT$H UOLkAL& 1H5 A)dIU8DD$tDL$pHHt$LmA3DSAuIUEbDL$tD$pE]H 5YHNYHDIL$@E1HtE1f!APLE11t$\J_AXAEEHTHGSHDHIUAuE1PLD$1LA[A_AvCAuIUEID$@E1HtE1f!AHM_E\EH kHjHDwLk 1ɺC1H5m I(jHHME11IUPE1Lt$jAuH ALi1ɺH5Z A'HD$ HMHD$(HIHD$@HEHD$HHAHD$PH=HD$8H9J@Lj12H5jt'}HpXHHHtjH9teH@LLHHjH= ÃHu HDwA9HHDL@HM#L H5Y 1A&HpXH2IGHtnHHtfH9taHBLLHHAiH=ƨ ÃH HDwA9HHDLHM+Ld <…tH U@tH UH UHl$XLl$`L H\$hH5X 1A%I$AIHRH\$DLLqHH1HoHtH;XhuHpXHtHFHtpHHthH9tcHBHT$LHrHogH=7 ÃH# HDuA9H6H3DL2H[Lg12H5gu$%HHTPE1E11t$Lj.H AEHNHOHE5EHfHfHEHHCT뜅H THSHEHl$Ll$XL H\$`C H\$IGHth I?(L(L8e1ɺF1H5 Au#Hl$Ll$XH\$`sL 1pH5GV H\$A-#jLx i[Ar-m1ɺ/E1LdHl$XLl$`H5U H\$h"uAVIAUIATUHSHHYHH5g%HAH9C@Hk8HHLLAă1Lc1H57 "K@IpBHshuLc1ɺH5 !^fDS@Hk8teHHLLAăL8c1ɺ1H5 {!K@hHC8[D]A\A]A^@IpBHt11scuAHHLLkAăAHHLL;AăCH8HLLAă"HHLLAăH(HLLAăhIpBH 11Ab@AWAȹOAVIAUAATUHSHdH%(H$x1ILH4$H1HT$@DD$HL|a1ɺH@ILHH\$HHAD$ lBD$hBD$@i_T$@|$Ht\HLLHAŋD$@tzLHH$xdH+%(EHĈD[]A\A]A^A_fHHED1M|$E1E1LPHATjH AŋD$@uHpBHvAeiL] H5 A<@HpBH1HW `Lγ H5_ A:LHf.LHL_1ɺH5 1AT(@HG@HtfɀvfDbfHG@HtFfɁf!tfx"tf%fffHHH9кHDHt GdvHHHQtE1xLAADfDHG`AH$rH%ArH0ArH-ArA uA@uAHxH1ArH A{A iA WA @EA 3HAHA H$AH%AUHi(H5P H$&AtH5b H &EAD]@AvDHHG@VPHt,ft"9t@FPHfuHHv] LL<tƒE1Ƀ1L XH5 1HL N 1cH5 l1L\1ɺ^H5{ K1H@%fD1ff.ATUSHG@HdHfhLjL% 1RLۯ LA1AZA[9dHdA1H5 L_ L]^_[]A\ÐjL%m 11RE1ɺLS L1$dXZLL1LY 1ɺ[]A\fDLtHLj L1U1ɺAXAY[]A\DATIUHSHHtHjHC@1Ht $t81LHf%f=uHu%[]A\1f/fH{1L<H{HHsuLY1ɺ9H5J fDLtY1ɺ3H5J []A\ff.@AT1SHHƻu*AHC`tGHAHC`HD[A\fDHC`uPHAHC`HD[A\LL* 1oH55 i1E1LLí H5 dff.fS1HHK`HHt5L > t*1L H5 f1[f ‰ЃtHHHHEHK`[L AWH AVAUIATUHSHH(Lb0Lz(L$MLDBtx~BDHG(H52 H8Q AƅvHLH 1MATLֺL0 YCA^fE1E1}@t$Hs H;sD\$HI}AA$jEM{I}HsAA$HD$ $EM{LH= HXY1HL$D\$1MATLĭ 1ɿH5F XZ?f.LE M1E1LֹLB LT$Ht$1ML CAM 1LlE LKB LLT$ILT$A@E1L*E 11MLֿD\$L ACD\$ƒ"HDEYEtC@H([]A\A]A^A_Åt8{@uD5M1L H5D qSC@)fHLOD M1ATLֹL@ LT$ Ht$ 1MLݨ L$$A^CAZE1dfDD\$HM1ATLC 1Lk LֿLT$AXAYLT$D\$ESL{C 1M1L LֿD\$LCDt$D\$f.D\$H11ATMLC L LLT$Y1^LLH=ȩ LT$D\$ET21LH=ħ L>AąHLD$I9Lt$DHI9HCLHHx@AąuLL 1H5w G0f19\HHxA$LjDhL1H$LB 1H5 XZL\C1ɺ1H5϶ f.As A11=ff.fA"11ff.fAUATIHUHSH8dH%(HD$(1cooHH)$)\$ToAŅHHH9t"fDHPooKJHH9uHHLA0HD$(dH+%(upH8D[]A\A]f1E1L* H5y ILL2 1H5E { ff.ATL% USHFXHHtL`Ho@HtiftN1H- UL1ATLݞ H5̴ HCX1XZ[]A\f.f8tFHHHuL@1ɺH5i >1f.fxtHPD1@AWIAVAUATUSHxH$Ht$8HT$@H$H$H $D$LL$pH$dH%(H$hHH$HHD$xHH$H H$HH$HէH$H$HD$0H$H$H$HD$`H$H$D$lHt 1H9 D$lHD$@D$HHt H9D$HHD$pHD$(H*HD$(D@Et HxD$lD$ L$H> HL$8HLHHHHD$HL$#D$lD$LI9FL|$DvhD$ImHE H]HHHE`HzI|$ Dt$HEyH7HD$H@@Htf!Ld$@I,$I9uHmI9kHuHuAQSHD$HH5f/ 1L. L1;IE^_L`HLt$@II9Hf.HmI9HuLwuH+Lt$@H9\$@u;fHEHI9t-HHsLEuHCHHHBHHEI9uHD$Ht$`LHxuxL} 1 H5}. L|$dD$HzI]HC`H7xl$L\$IEHD$ Ht$(D^EtXHFLD$ 1HL$8H|$@HL$(HADY@Et DPEIEHD$ HD$ 1H5- L$ LHH1|HD$HxY]HfH@IUHPBd _H$HtHL$0HH$HHHBfDMmL;l$L|$HqHnAt]L 1ɺ1H5i D ܛE:H$Hl$0H;\$0HsLHH9uH$H$H;D$0D$D$LG k H$LhI]HIE HHAEf@H$Ld$`L9uQ @HmL9@ HuHWuD$hIo(DfEfAAG\L ÃE1Ll$PMMMHl$XH݉L$HD$ @II(D9|$EIEt7IF`/JH$Hx)m L IH1VD$LfDH$HH$H;D$0HHD$(H@ t D$l HD$8@, |$LL$HHD$@L L9Hr H-" Dt$LHL-6 HHID$HMH޹WHPHHD$HL1\HA9DLXZD@M$$L;d$@uDt$LH|$pHHHHHt$(L莝 f11L411L4{oHL$JT=pE1HB1HI@H4p"HRHf|(tHH9tHHuAHH9u|$DD$ 6H$H$Lz<H$H$L`1Ln02H5q0Le/1ɺ 1H5 _D$hH$HD$XfE1Ll$PL z D$AEH$ILH$LL$))@)@ )@0@AtSAH DtHsA@Ic1IE)LLHIc]A9~ AAuH$H$Ƅ$_Ll$PD$HL$fL|7it$X1ɺ $ILk 1H5l XXZD$PH$fLhH1ɺ $ILH H5  1HY^HDLM D$PQH$H}Lt$XfA)LA)FA)F A)F0nHLf&hH1ɺ AVIL? 1H5` LAYAZHD$D$PHh(H$HHD$Xf)H)@)@ )@0qmLfA[gH1ɺ t$`IL! 1H5 HA[A^HDH D$PIDD$PL|$EH$HpH$HtL$hHT$(LЅH$H1ɺH-E L HCHLHHHD$@1ZYLLt$(HsH$LH|$ptIFHt@DD$D$H=l w:jLl$PHl$XMD$HHHD H HLt$XfJ|=A)LA)FA)F A)F0kLeH1AVI1L3 H5! _AXD$PgHH)v HHA|$hH$H- Hx}e Lt IOHL$XfJ|=)H)A)A )A0LjL4eH1ɺ t$`I1LA H5l XAAZA[fE D$PA11L)HH=dj 8D$L9M؋$\$LL)1ɺ1HD1LcKHDH HH 11LytNH$Io(Lh~DLl$PHl$XMAT$dH1ɺ $IL 'LLÅcHcH1IHH.t L7 HRH H- 1H_AXBt$hDD$LD$LobcH1ɺ t$`IL 5?cH1ɺ t$`IL HZH(H9H HmH;-:H}(HtHuH}aIHt@atpXH=وL 륺HLD$8Lz'1ɺa H5 vf.M$$L9$$D$1LkHD$(HL'1ɺ[ H5m ^H=g 6D$LHHHH@aH1ɺ t$`IL |$LHD$8HHH9=`t 5tHK HSHsH|$8THH2H9)H@HD$HD$H$`D$L%}H}L9D$[Ht$(FtLHFHL$ E1LH|$H@@HL$(HAI@t DxEHD$ t$`HTDd$@Et:|$t3$c D$@ D$DD$@H1ɺHD$(H5e L LL$1BY^D|$EbHD$0H9$OL9$`AMH$Hz|Hw|Ht|Hq|IH$|$DH=U H(|H$H!|H$H|H$H|H$H |H$H|t(L11[H5Y JH=T \$D"$Dl$`9M$Eu$  H$HD$PHtb8#t]H|$HC?htb cu>DcE,H$HtP,tHx@P,Ht$PH|$H H$H|$hDT$dE DL$EuHD$0H9$ HzHzHD$XHHD$XH;$QH$($ML|$HHRz$8Mz$ DzH$H9zH$ H2zH$H+zH$0H$z2$<$D$9MÉD$EuL9$``L$1#HDŽ$LL$fH3LH$HH4 IH$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$ H$H$ H$(H$0)$H$H$H$0H$8HA)$DŽ$H$H$L$H$H$ DŽ$H$H$)$H@H9uXH$HSHP"H$H(HPH$HHH$HM@H9 IV1HuLr H5}?L1ɺ>H54 1D$H$`HL9 H-s 0LJI1H5 HL9 HCHt HHtH9uL l?H\$0H9$oL$(1D$!‰$KL1ɺH5c TD$SH>HD$1L2H5B^fL1ɺ1H5 MH="O D$D@HHL9dHHH9uL9tHBHHH9uHFHBHD$MfMmL9t'IuHuL$Ll$x*DM$$L;d$0uLl$xkD$fDID$@HHHH9}LJ1L3 H5 HD$(H@@HHD$(L!o H5 LL$1_AX HLn HD$(H5i LL$1HAYAZHLXn PLL$H5 1 A[[gfrsHD$PHP 1Dl$dH_sH`sEHt$PH|$H1H$DH=K ]DŽ$qDL A;{@H茪D$dHD$PHH5H>HT$PHF1L 2H5  JZj1L 1ɺ#H5 ML|$HH=%K H$(DŽ$Hr$8r$  rH$HrH$ HqH$HqH$0HqL 1ɺ1H5G 3L 1ɺ@1H5!  H=]J D$LE5H|$hDŽ$H$DŽ$S$$HH|$h$ D$@$LD$`kH$HD$ cHt$PH|$HH$DH6 QL1ɺiH59 *HpHpD$dH$=@L11H5 H=&I $LDŽ$HD$hHH謧1LSZ 1ɺLH5w cHD$PHt[8#tVH|$H35<]tJW |Wu2 WqHD$h@,tHL$hA,Hy@Ht$PH|$HJH|$hxD$dLg1ɺH5 0LC1ɺfH5 L9$`CoHD$hHHtc>#t^H|$H2D%A\EtNV VS-VH\$hC,tH\$hC,H{@#HH|$HML1ɺcH5 $HƄ$ D$@$LD$`HD$hHD$ 1HHt$(H|$HsH|$H1JpHD$(HL1ɺH5L =fD$$%LRi 1ɺ1H5 11L-}wL1ɺHHHLSIHpTTAFbt1#LHH$L$PH$H$ H$H$H$IHtvL9tqLH11Ly H51 1HD$pLH$LЃE$(2L1La(L 4H|$H@HodLJ1ɺH5 EH$H9YD$LH$`MILIIL$HL9Hf.HL9H;Hu @L9tHBHHH9uHFHBHHC @HaHHUH9LLH[Lf 11H5 ID$1HՃHHH@PH0HHHH#HHHT$ HL$RHT$ It$HL$HR`H$0H$H$PHo)$o`)$HD$pLLHH$ЃDD$D$"RueRH$`M$$I9g|$IMED$D$f$uL :2L12H5QrID$H$0HB`H$PH$ H$f)$)$L1ɺH5 D$,DŽ$<^Lc 1H5 衿D$OfHEH}$Hh H}eH]ED$D$SHEHuL1ɺMH5, 6IML1ɺwb1ILc H5 MվD$HD$i$ DŽ$hH b$H5H=off.AWIAVAUIATUHSHXHgHHL$HD$(HgHD$ HgHD$@HgHD$8HgHD$0H^gXgHD$HHH5 H*IID$ AHD$H9NHSHB@HHHH9HAHfHLLHfHD$AHtHEHt@DD$ D$ H=S? At(L11H5 ؼH=-? D E9HH8fH5fELH;\$M1L2H5lML1ɺ 1H5Q A7H=> HD$(HeHD$HHeHD$ HeHD$@H~eHD$8HzeHD$0HveHXD[]A\A]A^A_@IHJeHKefDHa-T@HiHEH\\$ XPfDAUIATUSHHHo@H/1҉F$F9o_f `H fHC@71ҾJL0_CXfthL_AąL^fC uzL[` \@HF1Ҿ9^A1E1L_ DH5E 6HD[]A\A]HHHK0H `L` b1H5 E1HD[]A\A]HC@1ҾLYIm@CXHL]HC0C HC8HCP1ҾL荘HHCPHhL]CHIE@HHtfXtHHHAH[D]A\A]DKX/L~^ 1UH5 Ѹ@1f(HC0w uL^ gHHHs8H tL^ mofDHHHHtIHH9IE@Hfht+`L_ ~fX^PQL^ fDf(HC8HWH1HDfDH1IHH"DHAI}LEMjA$I}Hs8$AHs0HA$EMt1H,$ILv] 1H5 軶XZHC0HC8r@IE@r[-HHCP"fXt PHXHCPH1ҾLaCHHC8ff.AWfAVAUATIUHS1H(H|$dH%(H$1HG Ƅ$)$)$@D$8H$@zHD$(H$H$H$HD$0H$H$H$HD$H$H$H$HD$ H$H$HVLl$dI$A11J< I$NLHLqV IFHHHHH9LJH1xLQL I MIIFI$HBH^I$_u3I$I9$LF L1E1/*L-L HD$(H9${LU 1ɺL@1ɺ1H5 E1耞L 4Dl$@E3t$8L  L  L wL DL AL HAٹLPL1 U1E1ݝ[L=F ]1ɺWL1辝L r;HHL$谢LhHD$LHx{HL$HHtLH胫HL$HHy0YH$Hl$H;\$ t HHS1HHPHH;\$ uHD$tA$0uH\$1LG 1ɺLHD$DŽ$H$HH;\$ u@̐HAE`H;\$ t/LkAE`tAuXH=g?bL蚕LkAE`HT$ H|$HL$1D$EI$L3HH9\$DMAIELLL9l$IH|$1HSHHuLKLLL$HhgHLPLL$X1LQ 辛HHCHBH^I$_HD$HI$HCI$H(I$GEHD$I$H9t$uHD$(H9$HD$I9$t |$8wL$@tEHH9t$LHHH9t$uHD$I9$t |$8I$H9t$Ht$H|$0KAD$I,$Dl$HH\$0HDHD$@L$LuI9uefDMmI9tVI}LuIMIEHAHI$[HD$IEI$IEI$L(M$HH;l$@yDl$HI$HD$0A$0,Ht$I$JI$L3HH;\$0u=D**ILLL;t$0xILKLD 1L:1lHCPHSE1HsPAD$PH|$ EL$2A[ZwHHCHBHI$,HD$HI$HCI$H(I$.Lh12H5dʘI$H9H} L-v L9;LIH9LLC ILIHSL9uDHL9H;PuHHHH9LH11ɺ}LLT$HHCHBHH$HD$(LT$LkB HH$HCH$L0L$HUIL9LHIEH/LN 1ɺIIFI$HBHI$II$1LLIFI$L(1M$3HHL$1LhHD$LHxHL$HHtLHHL$HNjl$8Hy0&/IIFI$HBHI$II$1LL>IFI$L(1M$sIVHtrHHtjH9teLHL*M YL1ɺlL1ɺYAL1L1;L 떹L1L@ ʕ Ht$H|$0FLM1ɺ1L蔕LL 1ɺ1LrLMH;H9L  H 9$H5H=җ荟DHD$I9$t |$8A$0M$(ML@ 1ɺN1LI$(H|$HD$HI$HIHD$@HD$HHD$HH;\$0ECTHD$(HxFHHHD$LL;\$HvHCML;\$HbISH9B@uHHHH9LJ11ɺhLL9K L\$PѓL\$PI$I$ICHEHUH|$E11I$ HUI$ H*H$I$ o)$oP)$HsLt$@ILL;t$08HD$@D$I$I$HD$H]IH9uYHuH|$!=S$LML@ 1L1ǒHIHH;\$t}HH}zuLMLL?@ 腒HUHEHBHI$yHD$HEI$HEI$L0M$sH$L5HHHD$H;\$(H{LznHLSH(H9u|HmHH9teL;UuMIHL9LH1L? @H5LT$0臑HUHELT$0HBHI.L9umfHmL9t[L;UuMIHL9LH1LY? @H5N HUHEHBHHsH|$=O"LKL> 1L1ÐHl$HEHH;l$(HD$L [gLKLL.> tHHCHBHI$iHD$HI$HCI$H(I$hL oH|$% H$H;\$ ud@HH;\$ tVHkHtEatuXH=2蠉H؈΃QLM$(LF 袏DI$Lt$H-GG H9\$t5IF(HsI1ɺLL1VAYHAZH9\$uHD$I;$ ArL1ɺ1L I$L5J8HEHl$HD$HID$(H$H;l$0D$A$0t EThHD$I9$t |$8fHD$(HxyHD$`HIH]LE 1L1IWHD$LEH@hLD$@HD$PH@XH@HHD$hIH6HxHH1HH)HIIIILD$@IIID$(ME@HD$@ID$0HD$pID$8HD$xAD$HD$XID$PH$AD$X$I$H oA]o`AeIL1HT$@IHtdH9mIU@HHHH9LHH1L8 1t$HLHD$PIAYAZH H9HT$pHT$xH9H|$h(HHdfH|$PH@ @LhHXH|$PAH$HGXHG8LIEpHGI}`Pdt$X1ɅtbLIH݉H~`HGH@ Ht41Ht$@I$D$L$Ht$@9\$XuHLIAomH|$E11H$)$Aou)$HuH11ɺILAL7 aI}@XZs`AD$ tTI1ɺLB L1%DVI}@Eu$H=-11)1ɺL1IL7 ъH|$1LcIٺL= L8 11萊H\$`I$I$LkHI$ HCI$ HI$ H\$HHT$0H\$HHH9HD$H[HV@HLHHHH9LHL1L6 ډIL6 L1跉HUHEHBHI$HD$H\$HEI$HEI$HI$LL$L$ME@L )Lr@ LXIٹLLP6 2IL5 L1IU@HHHt{H9tvLHL1L4 荈L. IH5U1^IL? L1L 녹L1L6 3IU@HHHH9LHL1LLJIU@HtxHHtpH9tkLHL13 1ɺ1L苇WMtIIHtAL9ttL$ AsL$ t Ef|$-|$IIH9u!fHH9 HPHz@uM1ɺ1L/ H5+ avD$ H$dH+%(D$ H[]A\A]A^A_@|$IML9tIt$HSqM$$I9uLrAą7H* D$ HD$5uMI9D$,D$$D$(rD5EMgLuLID$`I$HtHHusulue@u^HC@HtE1f(ADDt$LD[u/AT$LH߃D$(ID$$@M?I9 7Dt$(EtE|$AD$,L SLE( PH, Ht$ LD11+t]A\D\$$Et|$tDEI}WD Et 'D2Ey|$, HD$HtsHPHHI3H@ I3H uTHQHAI3I3H u9u0h2H$SHh2Hx<@LI!=AHA1SHt$ 1L=' sXZfLj12H5frD5 EjHt$LS11_rHt$L411~rD$ A$uHJXHQ`utA$@M?I9f.LhLID$`HH[OHHIH$Hf@AE`]t|$DIL"LZHAA1L5q& L$ 1LLt$ +qAZA[D$ THL$HHX L% Hu'ZH{?tWHttoH[Ht5t.tҹuL1L  2jH[Hu[1]A\fzL1L  jfD[]A\ff.AUATUHH $HdH%(H$1t(H$dH+%(HĠ]A\A]@h2HIL$tHh2Lnt1HhLH! xHLjnzLHgL1ɺOH5 hCVsfDHHG@HtGf-t=HAE11H0H H-Pjjt#H HHH2E11PE1jjK#H HfHHG@uPHf!t}f(-uBHHSE11PAjj"H Hf.Htf!tL! I1H5(B gHf(-ufDL ! Dff.fAUIATAUHHG@Hf!f(-uxf$t(Lh! 1ɺY1H5A &gHHZL1PDHAjE1j!H ]A\A]@Htf!tL I1H5A f]A\A]f.f(-AfLi Dff.fAVIAUA1ATUHH1HtlIHE@Htf tHH&L1PDHAATE1j H LHAHD]A\A]A^D1L H5 AeHD]A\A]A^AWfAVAUATUSHL@dH%(H$1)D$`MA!IHAtfAfA&A+fAxfAtfA fA t/fA8A!LCfA(tfAHfA*tA*fAh,tA`,fAh#t EPAD tt HE(Pfxf MfA-t fA!@fAzHD$XIH H5FnD$1ҾH1bL$dHHHT$X1HaHt$hHZHt$XHHD$D$0D$Lt$XH$L|$pH$L H$H$H$HD$H$H$HHD$H1Lt$(L|$xL|$p~bMLL:jLt$pM9 D$ bf.fH@IVH$HPH$H $HPH$HHH$M6M91AtIIvHyIFHH}HeLA1ɺHt$1aDt$0Ht$H[H4$H[H|$pHL9t)$HDHWHSH@fHHL9u$HD$XL ; HH1ɺPL=+ L 1L`^_L$H|$XE1eHM@Hft"RHH $H $wf!A@d1fAfA&tuAf.fA85?@fAfA8fAxtfA&ADfA*)AfA}fA(n1fA[L H5 1An_H$dH+%(HĸD[]A\A]A^A_fM@Ѓ@A!E<.fA/1H= $5f.H1IWHHI$LML;$$IILft$TMGPL$tHHIH9fHB0HLHHL3H3NL HHH@H3NH3FH uoMvIHjL9aHpBHJ L PfwHN V1L QL1ɿ6VXZHH9LM4IH(L9LH=[L 1D1LUIIGHBHH$HD$IH$IGH$HH$RDIGH#HHH9LJ=rL 1`IWzdHT$ HT$ H HH9LI=bLHLJ 1P1TIIGHBHAZA[H$MIHL9LH=zL 1@L S@L @\$4Dd$8Ll$@L|$H|$t ߈H|$pL7L9t"HGIFL0XLM6L9uH$H9$tH$E111HVH|$(tsH|$(1dHHP0H@0H91HH9uH$H;4$ H<$H1f.HH9u9Dt$0L|$XA MJfDH5@L v@Ht$(L苭Dt$0XfHt$XHt=>#t8Ht u\Ht$XHw5E1DL 1ɺH5l ARD$08H IH`PHt$L/ 11QHuLt$pM9uDM6M9I~uI~IFHH}艴HfH@INH$HHH $HH$HHH$HH$o1ɺLL̒$QLh 1ɺL=0 1LPDt$0 gL L.+ -jWDL<1ɺIVI L AVA A%A кPHt$1CPAZA[Dt$0H$E1fDH6AH9uH1QHt$1L OAXAYHHt$gJH4$H[JLL$XMLN 1ɺ1ɺH5LCOH$1H;4$$EXH$1H;4$E1+YH $H5H=QAWAVAUIATUSHHHG@Hf( }H HmL5, HLKYcLM3HL(YL/HxAƅLH5 wLXH.u"L= HLXHc`LP/1ɺHL։L%5 1L1ɺ!LMH[]A\A]A^A_fDH.0HML% 1ULL MXIZL1L lM`AHHHHc`LHǃH9tDHPHHǂ H9uH.HHHtH5 QWuIE(fx{=LL :11H5 LH[]A\A]A^A_LM@1fHh-LHHD$L9@M|$Lct1Lt%H5E HApVuH. I M$$L;d$uL% HLAVuK,DHHLHǃ| LH VyHL5}# H;l$t4DLeLtL0tM$ HmH;l$uрc,'CaL%e 1LaHHG LHc`HHHǃHD$L9LHPHHǂ H;D$uH+gHtH5ѵ HTIL' L%v 1LAJ5@1Lҋ1ɺ'H5G JH[]A\A]A^A_HI1ɺATH5 L IY^H[]A\A]A^A_fLL LHc`L@L% IL L`ITIHǃHt2HINH{L`LHHLH"WHHHpT(LHy#HpL4IH5 1HE1H)1qCatL% qLLL% L%p1Lff.@AWAVIAUAATUHHHw@Hf( NH tf/1HIHHHD1PHAE1AWLjtH LHA"]DA\A]A^A_DuDD% E|H5 H蝠Aąo]DA\A]A^A_DHD1H= :HXHZH=LLLq 11ɺ=[]A\A]A^DL5 H_HL5 AHH1Lh 1ɺ8L=ID$@H:f/,}I$fHHI$HH1LIPL J1=Y^L11ɺNL) L#t+Hŝ5AE,tI}@AE,&Ht$pHR IH H] =ǾMPLRL 1Ƀ19-IY^Ht^FtU1LHmw HH5^q=_H* L 1ɺ1L,LecLHZ L H5 ,@L f.L=31M1ɺL1L 7,HD$Ld$H$HD$IZDL$A1ҾH 98ML7d 1L1+24$E1E11ATL1H=c jjAUjOUH0{LT Lu+Lm1ɺ@1H5 T+f.HHgNM1L H5 +Ht$pHt?>#t:HID%Et u芗$jHt$pHL%& Pu1L5l1ɺYL~*@L l1ɺ>H5 Q*Ht$pHtA>#t#tVH襖7tE wuMtAE,tI}@AE,"Ht$pHJN"Lz_LHo5DLL$pLZ QH5! (Ld$A.\$L- LL2كLH3L5,L9t+HHtL2HL9u܃=mL L11'Exy% 1ɺLLMi'1ɺ]LL-i'LHLi1ɺiA-5AL1L_ +'1ɺXLLh 'kuzL L&f L1L &A1L cH5 &L1L h&!-B-X -ML L1%&L1Lr &L1L %LLK 1%EL; L1%"1;L,g1ɺ1Ls%/y1LK H5v IDž<%1ɺLLf%L L1$L%k Lf1ɺL$qL溤L$LN MP$ILd$IIH $HH?HLeIPIXL;HCIXHIXHHmH;$uLLd$L Le11L$H H1ɺLLe#]H C$H5iH=+ik&L 1ɺ1L#H;LLQ z#DAWLAVAUATUHSHXHdH%(HD$H1I9IAL5 fDHL9t6HC@ctLHHL 1L=1E1"HL9uEAL- 1LDLL "L1L E"L1L Fc"L< 11HLF"HLI9ufDHI9H{H@t tEtۃVI@LƑH11L5 M$LL !HCY^H1M(LL l!XZLc1ɺO1LE1J!HD$HdH+%(HXD[]A\A]A^A_@L5 Lb1ɺ"L @)HH)˘L{MIhHHGH@PhIGhfL5 L 1Ly A#*@AWAVAUATIUHSHdH%(HD$xHG@H:fH"tHID$@Hf#HHDH9t-1HPHHHH9uA)HE`L- %H=t'L- H=tH=L-1 H(LDH\$0H@H5 |$0HH HELӉT$)HD$(\$ t$؉\$1HЋD$HT$D$ pLD$$M9tIM?M9ut$(D$ 1ɺCLLT H5APD$PD$ PD$8Pt$8AVD$TPD$`PD$lPSP1u`AUWHpHD$xdH+%(3HĈ[]A\A]A^A_f,"HEHDHLHx$j譄HHEH)DHLHx$$[IHEHDL$Hx$H$1ɺZATLL H5 @P1H f.HD$HH9t'1ɐHPHHHH9u)L$L5?1ɺ1L LL11L LdLMA9H LDLo 1ɺL1(HE1LL] H@LH(1HuE1HFHVH9tHAH9uHF(HN(H9t1DHH9uAL 1ɺ1LDM(11L L|E`%N=cH H HIHLT LP1RQ1+HM`HLH H >L L, HEƒLD1ɺP1A[[Ea=D1ɺ1L LE1HLL9tH{ߙHAI9u1ELU L1`H}1ɺLAL> 18D11L9 LD11L. LDL$11L% LHEHDHLHx$jiYL ^I11 LgHEHDL$Hxj _1AXIL L1 1D1L LHEH+HDL$Hxjz1ɺLH$D1L D+kHEDHLHx$$1ɺLDH$1L AYAZHH\$0@HL 1ɺ$1LIL_| 11%LID$@Ht`fx.tVHPE1E11P1HLjXX1ZH5B +1L E1HLH "XHJ@H{ H HI=u9H{ H HI1ɺ LLmX%=Hl{ HHVL 9pM@1L1L {EaLH>L  LDL 11HnL z @LW1ɺ?H59w HHG@Hf#tIf#ufH"LF ;1H5 Hfu f(tL H빐fufX*ufuf*ufuf#t f,ultfH"uH@HHE11PE1jjH Rff,HL% RLt MAWAVAUATIHUHSHHmvHHHLL9L5f.L{LtLt|HsHFPHt$HHtctZHt$1LL|HsHFPHt$HHt'tHt$1HL謽$HL9XHHM`HHDžH9tDHPHHH9uHtXHtL=LL 911H5X H[]A\A]A^A_fD1LT1ɺ7H5" H[]A\A]A^A_I1L* H5 H[]A\A]A^A_DH[]A\A]A^A_@H{HL&PL 1H5z XZAWAVAUATUSHLqHt$ANHD I1E1H$HII?1L,HLWHIH9uHH9HJH9A@uHHAM1L .Ht$1.XZA9nWELL=WLL$L H4$K11H[]A\A]A^A_DH%AHnf.HMA1L 0H4$1LR1ɺIQH[]A\A]A^A_H H$H4$1DL H[]A\A]A^A_ff.fAWE1AVAUATIUHSHXdH%(H$HHG@HtDVI4$1HLl$c}LIXLH TAEIH$@H5\$Ld$D$ SUtH4KH5]1HIHEH%=u?tH3HE11Ml$A0L1SHATjvLHD$,H #D$ H$HdH+%(VHX[]A\A]A^A_fD1L H5 ,DLHHWH%=*L|O1ɺH5( 8LLO1ɺH5 LH1LO1ɺH5 T f.1L2 H5  }ff.fAUATUSHHB`VHHHHHB`HHHH9tHPHHH9uHH=͝LLJ 211H5 : H[]A\A]DLMt2LH{LhLnHLLHILfD1LbM1ɺ0H5  H[]A\A]IL$ 1H5 i H[]A\A]f +LL1ɺH50$ I!L fE1AVL5 I1AUL IATUHLSHdH%(HD$1 H1D$ HE1LjLL$Y^IHHHH{1IL L0 Ht[}#tUL}wt OuvZAD$,tI|$@AD$,fDHL /t,LE1Q@HD$dH+%(u7HL[]A\A]A^1ɺLLKu .w@AWfAVAUIATIUSHHLqdH%(HD$81D$0)D$)D$ IFHHPHHH@ HI3$I3$H t0HD$8dH+%(HH[]A\A]A^A_HQHAI3$I3$H uAFH I}LxLskHHtLHH}HINI$I$H9tyH@Hz@tHH9taHPtoHD$H1M$Lv H5 )\$ob4)d$(P1ZYI$HHtI$;D$ u&I$D$ HtD$ H9D$L|$HCE1LLoHHXHp@A)oPA)W蔓HA|$ \$H9uD$2Lu&L 1ɺ^1H5 LtJf.AWfAVAAUIATUHSH8dH%(H$(1Ld$@HD$0HD$(H$H\$`HD$8HD$01D$$Ld$HLd$@)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$@HW@H\$hH\$`)D$p)$Ht*$fx  f&$$H52H Ј$IEH6|$0ȀEgAFMtM@H H|$`Lx[ HT$hIHHPHHD$hM9HIu1HJIHuMM L H5 1AtH|$(Ht;%=uzt HH$(dH+%(nH8D[]A\A]A^A_@H@SL 1ɺH5 1$DAuDLl$`I9t%fDHIU1HHPMmI9uL 1ɺ 1H5 L5=!Y HHHL|$`I9u@@M?I9HIWLHHuI_{d3HHt H9L tH/PL& H5 1AA]A^2fDh2L 1ɺL|$`I9Ld$L5G @L pM?I9IwHtHH@PHtLhHMtɺLLytH|$xHuLH}L`LdHLLHHD$xrL?H5 AUH$Hh2;IGHfHHZH9QLJLw AH|$xLd$7Lt$`I9H11L{ wH5 HIHDLH5MIHHD$`H9tL;htHH9u H H|$0Lh HT$8H $HPHHHD$8H=AuXL(M6I9MnMtAEatLJL qLA1ɺ1H5 L`A1ɺ|H5 1A$IFI>Hth L{L 11~H5 ZLt$0L,$L;4$t"@HIV1HHPM6M9uHH$H11LHHE@Hf"L"L$1HbLL5XYHL$xLL$HHL$ HL$O1LL D$HuƄ$L|$@M9uDM?M9ILuD$DD$1LH LWyAWD$ML PLA OH5 1A=LH}L`L`HAA.Et$AWI1ɺH$L! H5d 17Ld$0L4$L;$$u\fDM$$M9tMMl$MtAEatAuXH=˟LH|$xLR UHM1ɺ1H5 L H$H!Ht$xH!tH1Hx HE11HD$0HPH$LL$4U A[A\IH_DT$$EH@`Lt$PLt$XLt$Pt$MIH$I9|E1M$$L;$$ID$yHp@HlHEtID$HP@HrHHfH9]LH=1ALW H5^ .oL<1ɺ`L$HL$x1H^LsTKL$HL$x1H LHTD$WH$HxLHHDILHLHH)A H)HL$L f.HD$xL;1ɺM~1H LSVLL$xL pL kLL$xL H5 AKL[;1ɺHDŽ$LL$xLB H $H5>H=>L;1ɺH5r AALL$xL LC 19H5- H5 L7 1Lq/Ht$xHt>#tHhHt$xHk H$Ht>#tHh|H$Hg AML LL$xH5U 1L L.Ht$xHt>#tHhHt$xH<tfH$Ht>#tHgH$H=L891ɺH5 AwL91ɺH5~ Sv$ECT&BT )1ML H55 E@IH;<$LGHD$`Ip@HPHHH9tMH9uH$@LHfLD81ɺO1H5 fHQHPHH|$PHD$XL1HAHD$XHH?HL$XH;<$XHD$`H9HPIHHHH9LHR1L [QH5 YL ^\1H5 &LL$x1H5 L Ht$xHt>#tHesHt$xHt}H$Ht>#tHSe>H$HL61ɺX.1ML H5 L|61ɺH5 _LX61ɺC1H5 1L+61ɺH5 pIFHth I>[LSL f:LH$tIg`MLbIL$ILLD$ILpLVH>Ht$LHL1ILJIILJMt8LLD$ILpLmVHHtHt$LHuHIMH\$Hǹ 1I^L$I]LLD$1IHPHHT$UHHT$Ht$HHCpIE$tHooPH P0I}-aIUIFoH@@obIIIEIIEIL(M6ML;4$I(2UIHL31ɺy1H5E L31ɺ~1HCpH5 L~31ɺH5 H\$II*HPAo,$*Aot$rHPHHǂ H9u$LzLjL'Ht$xHt>#tH0aHt$xHiH$Ht>#tH`H$H-$u tHjA#L321ɺp1ILJH5 kiL21ɺjH5r GEL11ɺH5N #YL11ɺH5* L+ H5 vLq11ɺ1H5 Ld$`M$$I9fL *L%, 1L tHh2HALt 1H5 gL 1ɺ81H5 pf.H{%vfDHE@HEf7H*0L%. L L fDL% 1ɺ&1L*L{8?I1PHLPL*1XZ@LD H5 Ahff.AWAVAUATUSHdH%(H$1H5ʆIHk,AH31LUD$(HD$HCHD$EHDHD$ HD$`HD$@HD$1LH0vUfLIыH|$LD$,(LhH\$LH LLUL(1ɺSIHHt$L.HHfIhHt`LhMtTAvp9ppLFLc kH5 IL 11ɺLLVHLksLtHL(1ɺvH5l 1VHD$8#t>LS51}t?w qwC }wE,Ht$LW 'HA<$#t?L8S|tv  wwAE,LL L!D$(9MHD$HD$\$(H9D$ H$dH+%( D$(Hĸ[]A\A]A^A_ÐHL5HH(LLIHHD$8#tNLPRD-{Etu  vuQD%*vEE,tH}@E,Ht$L H(L$&1ɺ^f.H5s 1XMLٸ GH5? &L%1ɺqH5 L%1ɺH5 C@Ld%1ɺH5 @I}@AE,H}@E,k@LxnHhHt1IhHt%ZpL9XpHBHLEMIHD$8IL9>Ld$HLl$0aLJH1QH5 L IFIH@H HA[[L;t$8HH|$0LzZLHYLMfL|IHPHHT$GEHHtHT$LHOHIFIL$pHH@@HtHHt H9"L SfDL#1ɺLH5 VLd$HLl$0HHIMHt$0H\$8H9Ll$H\$8L|$XLd$HLd$@Hl$PLIM^H9M{ fHMIIGH3Q H3A(Li H upIWIGI3UI3EH u[LOI@LLPHEH1ɺLq H5 LHHAT1AYAZHmH9gHD$HM6L;t$0:ILd$HLl$Hl$PL|$XH\$8L9u7I~HGPooM6OL9rI~HGPH9tHuL!1ɺfD$(fDHfDL*fDLILϴ IFLd$HH5 Ll$Hl$PLHH1L|$X8fDL$!1ɺH5x Ld$HLl$Hl$PL|$XUL 1ɺmH5@ ,L| H5 D$(L 1ɺZnLz 1ɺ6H5μ L[ 1ɺyCA<$#tNLKuto ou@KD5oEgAE,tI}@AE,wLLtLL1ɺVL1ɺUH5 L1ɺ]H5 SML9t$8tQHL$8Ht$0IIFHBHH HI6IFHL0LML9uI}HGLGL9t@HULJH0HHHNH1HzHJ LHHHJ HHB HGL9uHG(LG(L9t@HULJ(H0HHHNH1Hz(_HJ0LHHHJ0HHB0HG(I9uHhAL$,1HAHIHˁ1ɿ1L H5 rHtgHt[Hm=mMH11L H5 _AXL1ɺ!L~1ɺH5ҹ hIhHh ff.ATUHHHdH%(HD$8HG@HtftIHZ>HEDLEu)HT$8dH+%(HH]A\HEPHUH1HHHx?HHHjE11jE1ɿjjNH 1ɺILXHD$EHUPHHMHL D? MȿHHHhPY^L苣kd 1L1ɺH5߹ $f.HL]uLUGptj 'kAD%2kE{qHYt4He`%HHH9sHtg|$ u L蘢j!H3u,HEu HTuHH#E`t@HpqfDTjELt1ɺH51D jEbbXDSEfDHH-/ )UL HI1V1L1ɺH9f.AUIATAUHSHTu5UiÅt?tDHLE1HEE1DHP>ZYH[]A\A]fku1LA1ɺ(H5A ff.@AWAVAUATUSHHuHF`HuH-HB@HHHIHH9LjHL5)11AULLL Y^H;1LHHLHI9uM?I9IWH9B@uH1LM1L% @YH^L#NHCH}@HH@HDžH8HEp+L)HCHpH8HD$HHH襝]OH'H'1HL肮ML=fL H116_AXMH|$ 2f1L H5 H[]A\A]A^A_LH-~1LHC`t DH1LL iH[]A\A]A^A_DHML4 L1#A[[Mt%I_HtH{hHtHGH@PhHChH|$ K1LRH5}fH1M1LLk E1XZI@L-1Eb@HE@HHHH9LJL1L"HD$@1ML LH1MLLp XZL YDR@HML ;HMLL BAYAZI_HH{hHHGH@PhHChAWAVAUATUSH(HLqHt$HH9^II1fDHPHHHH9u(A6uILLLAF L H([]A\A]A^A_fDAI$Lt$LtM$I9u9M?I9,IoHE`tLHI9IVB|H15IU@Htf(t ĀHOtHL=} >M1ɺxLILu 1n1ɺHL̛$1ɺ{LL91L1ɺLfLMHq1Lɧ H5ܫ M?I9@Lt$LLXLAFG=LL$1Lħ H5z H([]A\A]A^A_fAFH([]A\A]A^A_éIH}P@HKIIFHP HMHHALIH1ɺ31AWL" H50ANLX1Z Hl$LMI܉ÐL<@HIJ|8Gcu(HHJD8H@c'KLإ 1ɺ?IH51SHHt3J|8Ht)JL 1ɺBIH5j1HJ|85HHtJ|8T;]LHl$LM1H<LP1ɺQ1H5_HLPHL=[ L 1ɺlLVL1ɺ1H52L= 1ɺf1LLfHIL +IH5'1LH(HJ|8eILA EIH51WHJ|8(IL JIH51Qff.AWAVAUATIUHSH8dH%(HD$(1HG@D$$HD$HD nEL$ @ څH.f(tLe E<!I4$1HM9H5*jHI{n1H,wIHHD$IFEHU@1Ht$5mD$u mHHL1PAE11AVHj赅L$DH T$ Amu D$ wmLH4yMf%@L H5A 1AEHD$(dH+%(H8D[]A\A]A^A_ lE11L$ 0LP @Hf!Lע 8V@=[M11AL H5k |f!EL2 Lѡ f.HE1HLPIT$sAAV:_AXA<L 1ɺH5 AyfD=ZM11AL8 H5s Lq_ 1H5H AN@AWL 1AVIAUIATUISHLH5!} IH9E1L{LT-t&IG` u@utLLAjIHH9uEt;=XEH11ALx H5| dXZH[]A\A]A^A_AWfAVIAUE1ATUHSHhHt$dH%(HD$X1HG@)D$)D$ HtD$ELHL9E1fDIFM?AL9uEEubHHH9t1E1@HPHHHAH9uE<Ht$1DH= x#tML+5#tRL'DPEtJ JuI&D JE(E,tH}@E,育HsL_cL L=JL AHs11_AX6L/ 1 H5ƃfL5 1ɺo1LlL輸W1ɺLL=蕸L, 8H57 Ah%+HsMAWL! ~1AUL+H LLb H5݂课1ɺLLwϷ1ɺLLW请L# 1 H5j膷LL 1 H5:Vq HLT$*'HL'A_X`H~L$L$ff.AVfAUATUSHPdH%(HD$H1)$HD$FI1HI4$#It$1HI#HhI贺LH詺A~A)IDI9LH1LLLcH}LpL3HjLLH`IHHHLAIFHE11P1HAVjoH AD$LHbO@L 1-H57]ܳLx1ɺH5 1A赳HD$HdH+%(<HPD[]A\A]A^ÐL< H57 AhfDd$LLнxL$fHHcD$LHD$qMLɳ H5 A޲$fLl1ɺH5z A諲fDL<1ɺ3H5[聲@L 6H5[VuA<$#t9H3ItAC sCu~Cu ոDLH`L1ɺH5 ٱ@H$Ld1ɺDHD$LC1ɺLH 1H5> AjлUHBHL B`H H@LDʃ=BLw 1p(1VH5o XHZ]f.AVAUIATAUHHHG@Htf8t51ҾY~pAHD]A\A]A^Dft61LE 1ɺ3H5α A_HD]A\A]A^HHE11PE1LDjHj kH AHE@HrfXdLDHA9DLH]A\DA]A^@L\ )H5" A踯HD]A\A]A^fAWHAVIAUATI1USHH_HHH9HDI9>H0HHM$HNH1I$rI$L8HHI$HI$HCPI9tNLHHT$_AŅu.L1ɺ51H5O ݮHCPHT$ooKHELtx1L D9]Lv`H @HHȃ8uH@HtHL9u KH?L9t@H;GuLLHT$HT$uE1 @AHD[]A\A]A^A_I$I9tH;AfH I9uE1fH7H9HDI6i9_fAWAVAUIATUHSHLzH4$LHL$LHAL9u_M6L9tPIvLl>tMOHW1L H5 0HD[]A\A]A^A_fDH $Ht$HLdAątAL9huH$LhHDžhfDL?HtCHXHLE1d)HOL SI1H5 般XZQLE1%)L QIH5­ 1NfAWAVAUATIԺUHSfHdH%(H$1APD$$HE@Hf)؃~H5tJH@CLm@MtfA) Mp)I4$1HFIt$1HIHD$/LHHD$ϵgH_CH|$18IHL$E11HHMDŽ$jHt$HD$(A[A_HgHME1DŽ$1HjHt$ ߹Y^IHqIGH@HEhHE@Hfh#:LL$L-֫ 1L XLNAHD$8#tGHD'AEt4; f;D q;ExHD$@,Ht$HE}H|$sHD$8#tAH!D@Et: :k=: AG,Ht$HLW@HhLm@MfDpL؎ 1H5 A H$dH+%(HD[]A\A]A^A_ÐLL$Lg} /H5+ A賨뤐L 1H5 A膨tE1L 1ɺ H5 AK9fDH|$&D$P Ht$Hx Ht$H:HD$HL$1E1HDŽ$HjHt$ LL$8IXZMLL$(}IGH@HEhAD$xAH$AH$AGP$Ad$IH$HD$HD$pHE@Ht]fh#tSLn 1H5# L-p 1ɺe1LLALHT$pHLL$(;$LL$(tLH7$H|$$H|$%$H|$|$iHL$;APtAPL$M!A8tELLD$03HPHD$HHT$(HxIHHT$(Ht$0HHD$HD$L[  LLH5Dd1袥_AXf.L,1ɺ4H5ަ AkYfD1ɺLLEcff*f('fhHt$LmD$PLFJCMt$I\Ld$fDII9#I>11ILLtuL1ɺ~L-ӥ ALX 1ɺLL5H\$L- 1Lʥ OLI;#tXHTD:Et4 $5uD .5EHD$@,tHL$A,Hy@ĜHt$H H|$AhDI@AG,耜HL$A,Hy@dHfDfDL-y L1ɺjLAc1LUH5ɢfL\1ɺsL- L1A薢IK~fDMHD$LLL|$`HD$h=@HHL|& H|$m|Ld$`H{1HL[7H{L{MMLt$(I$HD$`M9L|$0Ll$Hl$8M|$AGdtRIIH9u=HmH9t-HuL2tH|$0HL$`LLLd$`I$HD$`M9uL|$0H\$(Hl$8IHHD$`H9tnMDHBHH`uCH r<ŀu7H%r0H$r)@u! uH0rH-QHT$`HHD$`H9uMI$HD$`HD$HL;d$(@Ll$Lt$(L|$0Hl$8Il$HE`H ĀML9uf.M?L9IwH81tLHI9EHLEIAqH4vH| HB1fDHHt L;jPHH9uIHHHH9iHWBV1L9hP@Dž@Ld$`I$HD$`M9L|$0Hl$8MI$HD$`L;d$(HD$L|$0Hl$8H(@H%Ld$`I$HD$`L;d$(Il$HE`H$sLHI9˺IHHH9ߺHHhHD$LL9upM6L9IvH/tHtIHL$H;MP IH4HL$H;HP%HL$0H9L$HtL|$0L9}PHt$H|$0HL$`L7L-P L1ɺcLL|$0Hl$8ÝL_1ɺkfDLL$L 18H5 Aq_@L1ɺ\L- fDLL$Lo =H5 A fDD9DD9yH|$0HL$`LL\L-- La1ɺLL|$0Hl$8蠜L<1ɺL)1ɺxL- LL$L HH5 AF4LHI9OILhHD$LL9ufM6L9IvL,tIMtIUPH9T$! HHL$H;HPHD$0H9MtIUPH;T$0Ht$H|$0HL$`LcL-ќ L1ɺwLL|$0Hl$8D|GLH@L1HILH4HIP1I9@HH9pI9tHHH9H0H9uZ1D9rI1L- MNHLŁ LL|$0Hl$8胚HL$LLE1LM9txAJLt_IH ILD>u=HNLaMIIH9ufH H9L;auHL9uMM9uM9Ht$HL$`LL-+ L_1ɺL訙LD1ɺMMt HD$LL9ubM?L9OIwL`*tIL9u3 fDH L9! L;auMML 1H5FBL1ɺL-> &1ɺPLL^趘'L- LF1ɺ>LL|$0Hl$8腘L!1ɺL|$0Hl$8MI$HD$`HD$HL;d$(Lt$Ll$(L|$0Hl$8&@Ld$`I$HD$`M9EID$HP` tHHH9!HH@HHH9HMHhL9u@M?L9xIwH(tH|$0HL$`LLKL-Ș L1ɺLL|$0Hl$8;L1ɺ}HHH9HMHhL9ufDM?L9IwH'tH|$0HL$`LLL- LD1ɺLL|$0Hl$8胖CfDLHHL[ L-ė 1LMH1L|$0L9xPIHl$8IL-y HH\LY} SI1LXZHxH9UL|$0Hl$8IHHD$`H;L$(NL|$HE1L|$E1HD$@IHD$8Hl$XDH-&H4wH}HH9H|$8>H|$@I/HD$8L9xPHD$@L9xP8 E1H|$HHL$`LL Ld$`I$HD$`L;d$(bI\$1H HHH9HC`HDHtH0HLqHHHH9HDH4~H|$8D$0H|$@L$0 ȈD$WMMIL9uMmL9IuL$tE1HHL$8M9~PL9yP8HL$@L9yP8HL|$HHl$XFLH;L{ IPSL-ؔ 1LaA\A^L1ɺf.Ht[IMtOML9ufDMmL9IuL$t|$0tH|$WtAIE1fIHLH@HD$8HHD$@^M9~PL9{P8tHL|$HHl$X8LH-LN{ IPS@HLqHhHHH9HDIH}E1HH9HtHLpHC`IH9If.MmL9IuH"tHAM1H5:Lx |Y^HD$L\x H5:L1EUI1H{@ML9H\$0LLl$8f.HH9HsL!tH\$0H\$BL-, LP LI譐;#t3H't! !uC!mHt$HA轵H1ɺCLL:(IZD$WD$0IHHL$HI9u(DH L9L;auLt$Lh1ɺH59譏HL|$0L9xPHqLHHL-ې 1Lw LHl$8]L|$HHl$XMLt$`IEHD$`L;l$(t:Hl$0LLt$MMl$AEaLd$`I$HD$`L;d$(uHl$0Ht$LVuAHt$H|$j\ZH\$I1ɺL- L4x HL1苎HK`L$$1HH3L$$1IL3H|$B_H|$o:H\$H_%H+At(LoL_LHD$H``HWotH\$HR__HA輆HL|$PH L ALDPL,w =11RA[[f.III9u1L9t@I9uL;pP@HI9HSpHCXHt_HJPHtgL9xPuL9tLJH1L-, Hl$0Lu L諌LG1ɺHtL9xPyL9n@HLLLOL- L1ɺLHl$00MH\$0L9LH\$0MH\$@I M$$L9It$HtH\$0M蔒 L|$05ID$@Ht>HHt6H9t1LJLh 1L|$0ZzL 6L1ɺH54UeL- L1ɺLL|$HHl$X$Ll$0BE1"xÑH|$@L|$HHl$XH|$8HLfs IPSMHL|$HHl$XbLHWLr IPS1ɺLLAm L1ɺ1L- Ls AL*HD$LT yH54Hǀ1.L1ɺ01ɺLLhA躉m1ɺLLBA蔉GL- L$1ɺLL|$HHl$XcL1ɺL1ɺ;Iff.USHH’8u 1H[]H-;IٿIH Hj"HDHH APH5uYL!5QP1ոH AUATIUSHHH蘍H{HDhHt HcC)9%D9DM։3Hc襕HHt)HCHcCHIcLGkH[]A\A]H{H1HCUHHHMu ]HH5 1]AUIATUSHH_HuBhMtL裌1LHֈL~H}uHmHt(AHH[ LeuLJIE IEH[]A\A]DAWAVEAUATIUHSHH4$dH%(H$1A=HDmHEHD$0E1LE1HD$HD$,M1HD$DIIDT$ fIE,D*HEHtHL"H=贇Ht0uP5 - 6 HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uH躇f.HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$1HD$ HD$$ D$0MHD$dH+%(uHbu F@ff.PfH=%@HH++H+H++H=?Ht轄H?Hff.f1ADAWAVAUATIUSHH4$dH%(H$1D$(HH$H<$Il$8*HD$HH4Lt$E1@E.DEXˀHfDEnIE6IDA uA#!A'A"IE1LA8tHBHEuDA tNtILrI@TA@Lf 1GH5} AdzH|$ZD$(H$dH+%(_2HD[]A\A]A^A_fIFI9HcÍSHL?YHDŽDHcHDŽ H<$H5| 1H<$H5~|  H<$H5s| GL<$H5r| L H$H-i| H$HFH$/` Z LuLHHPLEL~I|$LhLHLLH߆1ҹH=AID$HHuE1ҾrL9FR$$}H9gHD8-ux-uPKHH$-YH9tQHHV=u1܋W H-DHD E AH1Lc wL t`ARL[D$(IH L z 17H5z Afw A1Ҿ LRNLH蒀iA5)H1Lb vD 2DQHH9t$AAA9uELl$AEt*AfH$\$dImE1D$ H\$PHD$X $D$ AIH(D9~mJ EHu u>I|$H5 DT$HL$HxDT$D uA HL$HAID$@Htf(-u먋\$dEn<$"Af ft$tl$ l$@<$Ht$8ML$@E1MH1D$pH0@HD0@$MD$dLH|$hHD$ @MH[HfA|(ttZIS  H5s HcH>AT$H|$ HHLfDH(H99(uHHZDpzvh{q}gO]SIN?5+o!HXfDAfHcH|$hMLRHIL4MI(M9A9,$uHID$H!HH\fAD$XHMuE1L@AAI(A99A9XuI`HH!HHHAfAD$X|$pD$dHcljGD$pfAz(H5 tI2I|$L\$HLT$@tLT$@L\$Hf{(H5 tH3IpL\$HHL$@NtHL$@L\$HCf{(A|tHSH9fAz(AD$$tIRH9KD$XH˅ 2fvzgDMLl$ AM$E1E1MD$'$A<$ED$AI(D$A9t"DLy9uAAI(A9uދ$MLl$ D$@_ID$@H@ f)y!Hp)H$`1ftHH$h1ftHfH$ptHH=n H$xqHZH$`Ld$IHHH;Ht/ qH"HH9\$XuHLLd${fAt A$|$!9|$xt$@9D$tDEÉt$xD$twfAHcD$XL@IM$$M܅t9$d Dt$dEV D$p$fo$fo$$D$d)$$D$)$$$$HcH=+L$HiH QfIL$(H-j $AT$0taHtIHcHHcXL,RIIfB|((t&> 1I1LTfID$@1fBT((IL$(9|$H|$Pt$At$\I|$`H)fhH@L9ID$@HfhLhOLSA$gID$ @@?ID$@1Ht fhID$(LAo$HAo$XAo$hAo$xHA$Ao$Ao$A$Ao$fxA$A$fA$HA$ A$H'H HI#$H I$UIAŅA$A$xA$A$LA$oA$A$muD=TN Eu I$Ht1ҹH=oHuI$(A$A$A$I$0A$@6I\$@I$Hfh)tH@)L臽A$ID$hA$f f 1E1LR H5 cL11z LbH={HtH=rHtH=Ht7=H=H:H_tA$u=L/H=8tL|A$tMHpHHuI$0HǀHHXAML$11Le L>aI|$ID$HID$PID$HHGHPHHHuH=Ht&eHqH^HKH=42HUH@I$0HǀL)L1ɺ 1Ld`Hp6BLA$ID$ @@Li1ɺb LLA_A$ I$ M$ L9L=WHEHPHZH$H{HH$`dH$V$x%=LK1H-VLN H5_LKL2N 1H1_?H@LH'[L M L к1^HmL9D$\$t$D$@D$xHHcH4HiHH5g#H$H0HHDŽ$`1HDŽ$hHDŽ$pH$HrH9$ H-qUg8lC&H-JULK11LL H]HCHtHFHI$8H{HC0I$8HHHlL&1ɺ L5 L 1ɺ LU]L5ˌ L1ɺ L.]qID$LQ 1 H5 A\1H5` H@f$9|$d$9t$HD$0LI 1 H5 A|\HBH:HFHI$8HBHPHtHWHI$8H@I$0HǀHL誩L1ɺ 1L[vA$qID$(LEP LL1[DL@1ɺs 1LE[L藵A$ID$hA$t+LJ 1ɺw 1LA[I\$@H(&DEuML$1L^ 1} LZW_1ɺ~ LAL^ 1ZI$ L k L^ LHLE11Z1L^ 1ɺ LwZID$@HD f H%i1I|$fA@1,I$L$6$Hc$H5HitPHcHH ubHiH=7QHcHH8u,Ht$PH>t1 H9Ht$PLLMuLiH3B8D$H8H+@$H5HT$ J>J>N>DhDfEH8HxHt$ DPBIL$@H<.H|$fEt;A1MDSLHt:H<Hf|9(HI9uޅ(AU1E1LLUH!H4vHf|1(tAHL92Hu׃D$ $L$L=H H-Լ HH$GHHHtQIRLE YQLHL1IWAZA[L9,$IcEIT$@H@HHuHH맋-~$&}f ofHa1ҾL%JEDEt fx@ofx@L$`1DLLHMLZ L1VID$(AL$1LLoC ?V|$`|$xtLC 11ELVHc|$tHi11H=%%v$HH<$HHIH;|$>HiH1LH- LD HSHHkFP$PLL1VY^\ m HJ 8ID$@&L$ 1LL$`LfE Hc$HiHHkHHHdLHBf WMLB AWL1AJUID$(AXAYI$8HBHcfL 1ɺG1H5Tf%f8 IT$ RA$@t  f A$@ A$fx@LEA$ 1A$l3à   1IT$@HA$Hf fA$DfhEA$^A$\$$u 1ҾL5!<$A1PLD L=[ &A$-H &H-=0 &H( &P1WS9SH 1ҾH'LH%H 1ҾLHHH ?HH?H)1ҹLHHD$ ]HI @LKL11D$ 6D$ L^1Ҿ+L,LHA$ 1A$1)HHgHHL=A \t-H51HL=A i\tLHZ\I$LH?\LA$@HILD 1P L1QAY1AZ*L*H=roDŽ$HHHHHHHIHn"HHL=HH}nHUH$HHc.sD$EID$ @@yID$(pH 1Dt!D)HD9uHH HLHu@H5YNHHLt$HT$PLы5d ADžO  tA$ID$ @@1ҾLLLA 1ɺ 1LOA$I$H-aA$L? 1ɺ 1L^OALL@ 1L 11 1ɺ1H5mK8nHMHfLj> H5mKLfLO 1H5^mpK=A$1L>> 1ɺo L2KID$(L> 1ɺ 1L KA$1L<> 1ɺ LJA$HA$U1L= 1ɺ LJA$HA$A1ɺ LL); 1hJGAL: 1L 11AJA$11LwADžu:ID$ PA$@t ID$@HDA$1dLy1ɺ 1LIfS8I|$L; H1I $P&L1ɺ ?LL$ L.; QH5He1IH=`: RHD$mfHRL1ML6 H|$H ALH8uLL 11BLHHc|$`HH H= A9HEHLAPLWP1TGH 1L5 L0GK1H9BH$H9$LI AH5I AFuf1ɺL LL]AFLF1ɺ^ *1ɺ[ LL$AvF I$8Ht!1HHHHt9t7HHHHuT L1L]5 AFHHHtHJHI$8HxH@oHLLd$H|$PLM[4L3 xff. fAWAVL5{ AUL-! ATUHSHHdH%(HD$1DƒHSL:M=LH$$NIHLLE)*LH1LLLH/ ƒHSL1HLDH5aI ]H4$HHH<$I/4HSHBHCL:M3cDH5JLqKH/ƒHSL1HLDH5H 踟[H4$HI1HT$dH+%(LH[]A\A]A^A_HSHBHCH5oH LJHt|/w]ƒHSLM1HLDH55H Zf.HSHBHCHSHBHCf.1HH5L輞_M#1H5G L7 H4$H5ZG L7 1)H4$ Mff.fHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$cHT$dH+%(uHFLfDATUHH IHt5HFE1HHTL5tAHL]A\fD1L1ɺH5E ^HL]A\I|$E1ãL߂11H5E !ff.@AWAVAUATUSHH|$D$dH%(H$1Eo$)D$ Ll$(MDAHHl$0L5YE HD$ALHE1fDANjSD9HsD)IcDHHcMtIAL$'  CIH1۽ E1K4.D)Hc=CIDž~~Ã~$LcH5D Ol.L3CLc)؃L9MHcLH>I늋T$$qHt$(H\$ IEPv Ht$01HH4$HIcMH4$HL$1H L0E11ɿA1HHIcMH|$HE1H |011RASD9eAD$hhE1H|$(H;$ t $C$HL$iY LqLiH$dH+%(HD$H[]A\A]A^A_ELz3 11۹bE1E1H5B ApAEL$HIŸGED$>LD$ 1Hѵ1H$(H8ߗÅtDLl$(M1L"3 1pE11H5JB  1E1 G G11L1E11BBFfDAUIATISlHtG1LH5A HHHHtXI\$L[I$ID$A\A]fLl~1ɺ1H5~A 1f.L<~1ɺH5KA H{1xAWE1AVAUATUSH8dH%(HD$(1L$MoE1L$HGHD$ M&fD$/ƒHT$ D$L:M=LDHHL@I~HPHHT$賞HHHT$LHIHH5r L)L{DL FAC%teML1 H5? 1ME1DHT$HBHD$L:M-E1MAAs]%uAtuAyD$/!ƒHT$ D$HI~H0HVH(H@H@MIT$HPID$IMMD]DD$/;ƒHT$ D$I~HHDD$iDD$HHH@ H@H@H@MtID$HEIl$I~ DD$HfI@HE HX?HT$HBHD$DAD$/ƒHT$ D$HLHLQIHDE1HD$(dH+%(H8D[]A\A]A^A_HT$HBHD$DHE DD$fIoHT$HBHD$[DE1ɹL|. ^L= 1H5/= .BfHH|$ Ht$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$ 0HD$$$$UH HT$dH+%(uHB@USHHHHt kHt6H1H8I@vBIHtAHL[]ÐHE1L[]N79}+AABHtD@f 9}BHtE1UHH}PteHtW 17H;H};H};H}X;H}`z;H}hq;He;HY;H]P;K;fE1HPHfFF HOPQAAADpփp pp P,Qp(P$QPQ HI(PHHPHH  ʉPDfDADfDAVIAUIHATUHSH`:HwZ([@IHL>ID$HH>ID$HtNM,$I\$[L]A\A]A^fE1I1L* RH5Ŧ[L]A\A]A^L + bH5VIl$HtH91HH5Hq9I|$g9LE1\9YL* ]H56A(W1L%* H5 fD=Su H=&8[H&a{5xc=H8:L 8 1PHl LuPH531XZATHdH%(H$1H5AL%1H$H %H%H5FP5~>=%w~0%AH$dH+%(u}HĐDA\LI) 1H5nfK3 tDl$l$ 2Lo1ɺL%1L1LL$ ʟe2JLL$ E1fDL,o1ɺ{DLo1ɺ8L%1LSLn1ɺ1L5EL# 1H5 TfD68H-3|$ILIH HSH 1 HDHAAPLQP1H D:116.+6H-tL%%8f3|$LIIH HH HDHAPLQP1Lm1ɺL1H  DHɪL|m1ɺD1L&(6AWAVIAUATUSHPH8dH%(H$(1IVHAIH!E&AtIcH5Z2 HD$EI~H$1hPHHe MnMv/L1HHPLHztLvl1ɺ6;H5pHLE1f.AA1AuAH$AąD HMc&H$EaDŽ$D$xfDAdžD=%MnAwDL18MDI}.Mm H\1MuA,DH<HHH@I~pI~`I~XI~h HD$fMt4IH4$HL0 LM" N 1Mc&Am,DH<HHH@IFpI~XHD$HHI~`I~hHT$1-HT$HH@HD$H9I~`HHT$-HT$HD$8HpH\ Ht$0H9AGHBEtHۃsH޿[3IHIH4/ A_ LAG8PAP@AWAGAF4xMD-McN0Eu Ef8EE1IcF4IAOHH H%H L IG(IF=a%H HHA>I012IHBI12A>uAOAVxt,=% OH4$L\" 11sAF(tAOAtAOAtAwAOAt0=%wH4$L+" 11AOAEEt=5%AO@EEt=%,AOAF,AoI8AG AwDHMnMIL|$ HD$H$HD$Lt$(M@MfL*H2IH|$LDŽ$L}(H$IFH$ 1Ƅ$MnEeEx DL1H\uLb*Ht$DPL9@Ic҉HLH9,t @LA\u A\EeHID LxEeEu@HHfo$HHHUH)艄$H$fo$HE ]HeMv MH@H4$1L nH4$1L/! LD$EA>EEwD$xD$xe@ *Mc&I~hHH|$ I~` HT$1HD$0(HT$HH@HD$8H9GL|$ Lt$(M1H4${L\ qH4$L e11RAW 1L$L<(H4$1L fL|$ H4$1Lt$(L Ԕ^H4$1L1 3L|$ Lt$(HIvXHt HT$H0Iv`HtIFpHT$0H}HEd0IvhHt HT$8HN0IcAGAV| jAOt AGHHet =%vAAO @aD$|IcHIn`HD$AG D$HHH5' +H' HDIFpH5& H * AAEfAnF4EN(EVxHD$ AE^|H HEAHD$hAH) HDHD$`AH& HDH& HD$XH& HDAv0HD$PHz& HDHD$HHx& HDEfA~HD$@Hm& HDEHD$8Hf& HDEH m& HD$0HX& HDEHQ& HEHL$(L8EtfL f8=fA~I~XHh% L%ֲ HD$pL„ L HAIO0MHL$H +% H HDHH$PD$(PH& Ut$@$$$$$$$$R$$ARAPL ATVASWAQL 1AU$QH$H$Ӌ=PL1$PH AcD\$|EA>LrZADWEt'H$H5 L膗AAGe7<H(AW 1L`%L[#QfDD$|}'8A91AAPt xD\$|AgED;UN=%AG H4$1]L LtA>LAW 1LLj"DfI~XH 1f8=HD$pIIfA~IL ށ HH=؁ IAG A1_AN.΃ fH# HcH>f.AG\DH-%HtzH|*&L%s8l#HL " PH" LEPHеH5 P1AHEHEH H4$L]11.fDH- `@H4$ 1Lq KfLLDT$@)DT$@K f-%Hu q"Av0 fAnF4H=?zf~BLD L L HIcPH8" ARHWQ1AQL 81VAPL AUt$PHt$PHP1A$XH4$1L ;ffDHI~IIMg(MIG0 HD$?IHuH|]IEPPHH0HG1P8H4HI9uLd$Hp 1L %LAF4AT1L bP1Ht$EN0AXIFAYH4$1Ly vPALYL  tL  H LEH$1L HAL H1AO EL6 1E1H5sH$(dH+%(dH8D[]A\A]A^A_f(H4$L0 11TAOI@IVIH1HD$0HD$8fAOH$H cA^01HDŽ$IHHHHXL% H7H&H x.LhuA}tހx.uA}.uA}tLL!t/L=H HPLL` 1ɺH޿LXm@Av0fAnF4H=uf~tfH=o{ f8=f~L L Q LB{ HIcPH ARHWQAQL D1VAPL AUt$PHt$PHPZ% %"@%D9-H1ɺLPLY Ht$1Lc %EN0AZA[AAN0fAnF4Lf~…H=ttfH=Kz f8=f~H54 L Lz H H L$Hz MIEHASWRVQAPL USPHHHD$P1AMc&HPfH=y f8=f~AuH$Ht 8 AvHA~LIG(tJHHjH jE1E1W щHHy VPjH$H0I~PHtW 1HZM~PAEE 9HH MnMt-/LH HPLH]8 IHtHi AF0HE0AF4E4 L}LHP H&HHu1IHEP@A;F(cMVMMMDMoL$LdL$HHPuDHrMoID8 tIIIWMjH9 IBIOH9 HLLT$H$mH$LT$K IzIwL$KL$ALE4DM0 AUL 1ɺPH޿1AY^L L$1ɺH޿1MJ\MO1ɺLn H޿1:L$MR M Mt MM I H?AdžAF4qAN0u`fAnF4fLv 1f8=LMMf~L萜LLS11H5QIHtHEgAF0HE0AF4E4AFIvELAF4HL ^P1Ht$EN0}^_6H-9p HHPHHH% 0HH{HH]PACHH;1E10HPLLTLDCEDHþ/L{ LHuTlLLQHE1LL;L111H5@}|L1ɺH޿LKL|kLLfQkLHPQAF,H$LM $ERLK1ɺH5{-HEHHE AIIIdžLIdž讁LÅzE1H|1E1L H5{eLJ1ɺN1H51zLΓLJ1ɺU1H5zHL藓IG(Q1jIHjI jAA ҉HwH$dH+%(XHĘD[]A\A]fD <*HHH(H}PH@Eu#L-rLVF1ɺDLvH%tAODL-)H\$@1ҹ@H55 HHuD$<$H^LL ID|$@L LEPHh P1vXZ vfDL-LB 1:Lu$N*f.ƒxÐHt 1=J%%Hff.AWAVAUATAUSHHD-ddH%(H$1EtH~0HE蹀H5W[ {Aă t2H$dH+%(HD[]A\A]A^A_fDCHH;t1IHLs LHŸEtE蹀LLH5Z r{A!tHta gXIHf@HCID$HsA$HtHID$HL[]A\f.LfL$LHHIHuL 1H5fLu 1H5̟ftfD1ɺE1L-6H5}fFATUHSHH5J H;u6AL 13H5G&fD[]A\fDHHPHH0L"LH H@0@8HCHtt1LH59 HXLHA>fDHLHCHtH@Ht HSLLMd$Mt EA"LH!LHA1 fDL%E1L Le\L,1ɺL1G\DMHEdH+%(aHeD[A\A]A^A_]fD1H5Hw~HL?EI|$1HڍHzH;y1LH5 HnE1ɺL++H5{[DM/f1LH5: H+A>tnLHMvMtRA>tL1LH5 HuE1ɺL*H5 ZDM1LH5] H<E1ɺLQ*H5ZDMULH%ML*1ɺ1H5|[ZE11LH5\ HE1ɺL)H5-ZDM HfJ HeA1AփH<1D9rHʨ9fL%L ELwYL)1ɺ E1ɺL(H5]AYDM1E1ɺL(H5*YDME1ɺL(H5XDME1ɺLf(H5ґXDMjE1ɺL:(H5XDM>E1ɺL(H5z^XDME1ɺL'H5N2XDMEL'11H5%XDME1ɺL'H5WDM:f.AUATU SHHHLo LgLoM9,LHH2Dq tVI9ufDDA t!HHS I9tlH< uC(fDHSI9tSIHS H2Dq u@#uMI9t(HB@0H@t@ tHC HI9uLHSC H[]A\A]Au@t"HB@[wH= @Hc4H>C I9u38HDq u%#t =t{tHI9tuЅtCHC H[]A\A]CtNI9tH0Dqu@.uЃ{tCHI9uDCCC C I9vCCnCbC VCI9FRH"t"t\t.HI9$QH"uI9HHI9QHtCI9uDtHI9'uff.fATUHSHdH%(HD$1@GH5 HcH>HHIHH}0H$HIHHx>}U(HEHH+ELT RLHf1H5]E19TXZHD$dH+%(HL[]A\HwHW H0H)IH(}U(HEHH+EL RLH ffDH0 DIHf@0H}1H ZAD$}U(HEHH+EL* RLHHIHH}0H$HIH(}U(HEHH+EL RLHffDH0 CIHf@6H}11H`ID$te"Hu@HH=FID$[EHPUHu%L 1ɺH5!RDuU(HEHH+EL RLH{L) !H5Ɗ1E1QdW(HGHH+L RLH"fH'fD1HfHsfDH[fDL 1ɺ1H5PfL| 1ɺ1H5߉PfHgfDLo fLq DUHSHHHH84AHt/H;HhtQHSHHPHSHHCH[]L H5OH1[]Off.@UHHHSHHHH9u&fDHH9tH;XuH[]fDH(tH{XHH[]fAWMAVAUIATIUHSHH(H?DL$dH%(HD$1@HxHxHHIHǀH1H)HLH;HPHHT$?HHT$LHLIFH;LhL?HLLHoEH{IIFD$AFoMAN(oU UfAFpIFHIFPHIFHIFXIF`IFXIIIEHl$M~xHH AV8H H%LH кHD$赋}A<$HD$dH+%(H(L[]A\A]A^A_@IF"1E1L H5~xMfDIFfDL 13H5A;MH;LE1 RVL(H{LLP֊,L 9H5܃LH{HjH;LE1Q"fATSHIHtHA$ID$@AD$|AD$,ID$0ID$8ID$HADŽ$IDŽ$ADŽ$IDŽ$HL[A\LE1L11BH5KA;1L H5KfDAWMAVAUIATAUSHLL$HtQD`0I@8h4t|L褭Aąu}L1ɺ1H51+KLS&L1ɺ1H5E1JHD[]A\A]A^A_f@|x@LL腢AąH\$Ht9IFPHh0HLL`L;HLHHHH|$PA:IFPHHbLLhL3;HLHHG871ɺLPHp L i%PLn1AYAZ@L%F8;ILIH9 H^nH I HDHAPLQP1AAEE1H L,1ɺ1LE1oFVf.L #f.H-4F8-M1PH՚LPLh1_AXHE8=.%MIH8 HPmH5rHDHE1APL VLP1DT$$H /@HFLH &8 DFHH HDEHH HEȋFwFHL QRWLNH51EH HDuHL QRF8PF4P1WLNH5DH0HfQL RF0PF,PF(PF$PF P1WLNH5upDH@HQL) RvWLN@&AWL=saAVAUATL%V%USHXH-YadH%(HD$H1H]L9wH= dEUHu8D]4H}@DM0DE,M(DU$Du Lm[wqiL_ME@A,HUHHEHHBHyHL9HDuLHEjH=q EfuAt H%CHD$H1MASL H5D\$$ARDT$0AVLT$(AH2D\$4H 8tEDT$ A}<L 1;H5BL>D\$LT$k81M6PH\H5PLLT$1AY^D\$#L-l>8e=%MIH1 HeHDHH |,APH5'LxQP1ADT$(H 0rfAVAUAATAH5 USHHdH%(HD$1HHHH1HT$H5qJ E1t6HuRHD$dH+%(HD[]A\A]A^fDD9d$uE1HD9,$Atf.H-4=8-;IٿIH/ HdHDHH | kAPH5LXwQP1H GDE1:ff.ATUSH0 YdH%(HD$(1x*YxRHD$(dH+%(H0[]A\H11?AEtYrYyL 1ɺ HHHIHt_HÅL 1' H5;LHX)fHLD 1ɺ# H-1H;H1LB 0 b;X1Lw 1ɺ H58.;1LH•%0XlHD$(dH+%(u*H0L 11[< ]H5 A\%:-ff.fH=U%u 5Wu1Ht=0%vߋ WtՋO1DUSH=M t8HA1W` H5 L  :Y1^H[]H1Ҿ1‰EyH-98t@ t[AٹLw Px S1H5 XZ1H[]DHAٹl SL DHAٹr SL DAUA ATAUS1HdH%(HD$1D$fDL$Ht$߉x\E UL H5 S18XZHT$dH+%(H[]A\A]fH- 4L-}88 HAٹ ATL H1AY1^DL-48H-, 8&A1ɺ PL, HAT1AՉߺHt$_AX`HEHSL AٹLT P ATG f.U1ɉ1S11HSx?HA 1SL H5L B7XZH[]@H$78AH5 PLF 1 UY^1H[]ff.AWIAVAUATUHSHhdH%(HD$X1‰D$At=\%fD-A?`Ht$LfADT$LLl$RL5Q D$1LDT$f|$VDD$RDT$1D1 DT$DT$RP L ARDL$ DT$1L5XAL% Z E,fH5DT$L H L 7 LJ DžHD$H)( H=; LI@H5B LDH K HDIH HDHT$H HDHT$H HDHT$ H HDHT$(H} HE@H| HD$0H' HD LDLDHT$8HDH HDHDȃHDЋEH- Hc\H>=2%Dt %E,ADžHT$XdH+%(Hh[]A\A]A^A_D1H=ΙLl$R1Aą LD0HD\$RfEtEAM D%f|$RtDt$HEL P Dt$(L5mD$L1_3|$11(ZYDT$D\$f1D1 D\$DT$DT$D\$PE1L AR LDT$(D\$2AXDAYzD\$DT$t(LX1ɺ 1L2DT$D\$DT$LE9+8 HW2L5OKL LI 1DtL1ɺ# 1L2A1ɺs 1LL1E,1fDL) L51L1pL D1ft$R@DT$Hd18XL) LPD$ P1DL$ELL. v 1D $1Y^%L1ɺq H50L5L 1 L0SL%081ɺ LPDl$L 1AUDL$ADT$EL D$DT$jHZ Hl$ UATASAUt$8t$Ht$Xt$ht$x$AQAPEL WVLQR P1SARH$ӸHĠH H |H pHdH XHe&LH @H 4H (H Hv H7H H] H Hr H> Hk @L #H# DT$H.D\$h8HL PDL$ L1AZA[t$|$IDT$Hh.D\$8W L PD\$ ASDT$ ED\$DT$DAW1I1AVL5 eAUIATAUSHDD$Lq DL$ IRVL-ZYHD`0T$LH@8HʼnX4@|Aąt`D$ Hˏ1AċtD$fRE1E11PH 1LjjPjAH0HWHD[]A\A]A^A_DML> L1E1,DžNAWAVAUATIUSH(HT$Ht$DL$ AHHD$ E1ALMjDAFDt$ < v1AF<v)AFA<vH=8 T$GT$EHtBL9G4,IIJD=D0EA\u|$ tB|=xA\tH|$ tHL)HvmK<,1IHH U @HL$L)HHL)HvI1C,IK@HULL$(L 1H5KA;+XZH(D[]A\A]A^A_MAL9t1C<DDDHULR LL$(E1ff.AVAUAATUHSHHHdH%(H$1蘽HCH{臽HCH臽HvQI>L 1H5SI*1H$dH+%(HĐ[]A\A]A^IAt'EHHCH_fH5˹ HHt\H1UH-L  L H)^1_1ɺCHL1)1:}hM_IEALLH5 H|0AVANUHL L%LE1L& L(LZYHCHML$ LR(1xIHL B IXL H5{v(1(ff.@AWAVAUATUSHH $HH $HD/dH%(H$!1IEuUIhLl H5'H$!dH+%(rH!D[]A\A]A^A_L$HLILAŅtpL診Hv/A?/t)IWL11:/@HH9usM~L H5G1E18'DH$MH(HD$H1HH} H|$Ht$ (H$HD$u H;D$H$HIHWH$@L$HD$L(H/x.LxuAtހx.uA.uAtf.1MHپH L Ht$LnuHD$H9$hwLd$LLrLtN衽H%8L G'1PHKLPH51XZLd$fD1LHAMs1L* H5rh%LxcH5HML 1E1%%1Ms1L H5$H$MHN&HD$H1HH @ t#H|$Lu+H$HD$ML 0ML7 Ѽ HU$8N=%H H IHKWH5&HDAPgL %QLx^P1Ht$(H Ht$蘻H#8ڸH51L :%PH6PL 1Ht$Y^Ht$Rff.AWAVAUATUSL$HH $L9uHH; |$t$ dH%(H$P1|$$H߉t$(H5d D$,HHIH$0L= fDL8L H`HgH$p 1LHL$`HL$ IHT$MYL$=H5H߉ $裷 $HI $IH{AV $H$_u'HH=^AT uLt$`LL$LƄ `ܱ/LƄ$L$HJLHPLkL$PLxHL茱|$;|$$t$ ;t$(HL$$L3L軺LȺ HT!8MHL  PHL[$PHHH5P1Dd$LH E8fD=H$D|$L$p D}t$ LD蠠L$01HپH LL׳HHpL=~ @HHx.L@uAxtހx.uAx.uAxtf.1MHLLwH$`L@裷8xHܴ1MWPHV H5PL1Y^HȹKH8荴M1ɺ]PHLP1H5iXZ@Lt$`fDL H-/1H 1ɿ1LHLZL1ɺ1HDd$,EAH$PdH+%(HĘPD[]A\A]A^A_@LLL$L$AB|LL$諀L$LHt$0vL$wD$L1ɺL' H5PD$PPAVD$8P1DL$<D$hD$uMtFHB11UL H5MMd$XZM?|f.MMd$M\HE1QH-~M11HLJL11MH,WAWAVAUATUSHH $HH $H_dH%(H$ 1HIeHW HwII)IH0XLD1ɺyIH] U(HEHH+EL_ RLH{1H5jLE1FXZH$ dH+%(H L[]A\A]A^A_I LL-B4 m H"A<$?M8H}0LLuIHEEU(HEHH+EL RLHf.苩L1ɺgIHtUH};U(HEHH+EL RLHjfL1ɺmfH5K1E1@IHtÃ} U(HEHH+EL RLHoBU(HEHH+EL RLHfDH}PtELH萹}LHHu1ɺE1LH5/JfDH;fDL1ɺ1H5IfHfDH۸I}HE@H肻IHI t%ML 11H5kIJMo HsHuPHELELL茨HEHMHPHU H9HDHE HPH9HЀx u8}ux uEkH۷} 1E1f.IFE t$ t|HIdHHtMuIf H胷EL1ɺH-?H1HL1ɺ1HE1 H&kL}1ɺ롾 HH}0 IHtf@"1H-GL HmOATfIUSHdH%(H$1H\$0HG)D$P)D$@HHHt$0Ht$HHt$P)D$`)D$pHD$`HT$8D$XL$hL$fH HD$(H$D$D$fHHHtp|$@ uH\$1I$HDHkH{HC违HCHHt HfDI$H$dH+%(ubHĐ[]A\H-?FL1ɺH I$1L1ɺH 1H-EEDATUSH@dH%(HD$81Ht_HHI @H[HtGHf11HL)D$)$HD$)D$ HtHT$8dH+%(u H@[]A\1跤ATII1USHH@HzdH%(HD$8HHLHD$HtGIt$ H{H^HE HtUHD$HHT$8dH+%(u\H@[]A\1LR1ɺH5D 1fL,1ɺH5Dp 1ףATIIHUDSHAHt3H@ Ht*8tcIL)S11-H5/D Mt-H11IATL1ɿH5C XZL[]A\@H@u8u Mt@IATAH5UHSH`dH%(HD$X1H+u Ht$0H\$8HD$8H/ HD$@H HD$HH H$HHD$H/ HD$Hw HD$PHD$HD$ fDH3HHt4H̚uHT$XdH+%(uHH`[]A\f.H\$H5$ fH3HHtH|ufDDfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1HtuAHtH@HD$8dH+%(uH@D[f.E1ffDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ [HtFH@ E1HtuAHtH@HHD$8dH+%(uH@D[fE1ƠfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1Ht8tHD$8dH+%(u*H@D[@H@AHfE1&fDAUATUSHHL&AHH1Mt L莚HLHIHC(Hs AD$(HtH軟ID$ HtYHsHtH{ID$Ht9Et HsHtHVID$HtHL[]A\A]fDL1ɺ1H5?E1Ő1E1L H5?fDL׹ 1H5?kjfDAUATUHSHIHt>1L-HtR@HDHH@H9uH3LL.H9t'HL1ɺ1H5?HL[]A\A]@ATH=UHTEHHHIHHxHHǀ1HH)HID$`Md$=ID$hID$`ID$pID$xID$pI,$GAID$H/AID$HHL]A\fD1Lx lH5;HSHL]A\1E1lL0 H5;HL]A\DL {H5f;eI<$E1HL]A\fDL< H5&;%I|$@I<$E1f.HHHIILPI9t+HzʖI9tLLL躖LLHHB`HJ`H9uqfHH9t`L;HuHzI9uISHIKHH9tHfL;PtHH9uH9t1HH9u{HIAXIqX1H9tfHH9uuzff.SHOHHDK4DC0H( HHDHH 1Ax H[H f1LJ1ɺH59HC[AWAVAUATUHSHHLHdH%(H$1SHD`D=H}DHމS?HHt L`MuZMI-H I1M|$M)MtPT$ MLLItuD$ LH-HIPH58^1L Y^H$dH+%(HĨL[]A\A]A^A_fLl$1ҹHLiHHI)LBD$/LD`D<H}DL/>L=HHt7L`Mt.LAVMPL kL=L-L躓LHHI u}N,#L虓LD`D<H}DL=HHtIL`Mt@LPHML Py1H5)7AXZIL 1E1~H56AmƄ$FfDHAVAUATIUHSHAEt^1HvVL5L虒LLHIt2LLH֐A1EuHJ4+LL)躐[]A\A]A^ff.AWfAVAUATUSH$PDD$@L$HD$ dH%(H$1)$)$)$HH:IHDLg|It$H1ۋ$@A$I$D$ Mt$xfAD$pH$dH+%(HL[]A\A]A^A_HHT$AIHhHT$HE1ML$LL胮HHHHHxHEHHpxD$@DI쉅At$I\$HD$XHD$`H\$hHVAL$$HD$`M|$AT$4At$0HL$xH|$XPAAWL$%A]ZAD$4I1ɺAL-3LM PAD$0LP1A[]HHEAD$0E8HE0AD$4E4^LHD$@OT:DT$@ENH\$`H\$H|H=jD HD$(ED$ Hl$0L$L$Ld$LLt$8D$D1Ll$ A@HL$DHlHL$I@HL1I LAI~A HEH LH H H$1@H‰ Љ1H9uL 1к8HH&HxHD$AD;(5Hl$0Ld$Lt$8Ll$ HYRH|$XHFRD$@f.L1ɺ1LE1f.L H511E1WH訍I?LhLyHLHH肖I$DL-T1Iٹ=Le L72fL1ɺ1H51fL-0L 13LLl1ɺ1H50]fLʩ IDŽ$fDIٹLL E1TH|$XHFqPHuBH;I<$HIHIٹ?Lߗ FfHHHlv,D$%=`IKL H51E1+91E1L* H5H$dH+%(sHĨD[]A\A]A^A_@:H?LLLmAŅLjHHt*I<$LLAŅAuDLı1ɺVH51E1FfDIFLv Lt1ɺC1H5LL1ɺY1H5fHT$(I<$E1E1LHHH  L1ɺRIHyfAWIAVAUATAUSHD_H_dH%(H$1Et-Hu/1ɺE1LmH5BHiHu]IٹL H5AyH$dH+%(aHĨD[]A\A]A^A_DLPIH@ H$dH+%(HĨLL[]A\A]A^A_~ALJL9tDLHHL} AVIpH51AYAZADH\$LHAƅuaL 1ɺj1H5UOf.Lܮ1ɺ1H5$E1fDLt$IhIXMXI9IVH9A>L95D$HT$@jL%d L-ؓ L9A{ACIcL>L\$Lt$PH @L1L\$AS(Aw4LL\$A0 L\$=A{HwuL\$8#H-1ɺN1LHLw1ɺ1HE1<DIKMC Lt$PL@L1L\$ L\$7fL\$AKLt$PH @L1L\$fL\$AKLt$PHa fAKECLt$P1H. @LL\$L\$fDL\$Lt$PHW fA{tYML9=ALJA>H-L-1.HHLL\$L\$A8Lt$IK I9uLHL$H?:HL$L IH51QAVE1XZfD1L9LL%H)HSAVIx1Lň H5E1A_AX7H-L-RHr IDL%= LE1{HL AUISH5O1ATH H->L- H L%uML%H-L-ӏ HL-Ï HՏ L% _HLAkLHL% UH-I=H1Y^1L\$HL1 EEKuL\$H1GEKLQ KL 11IH-MLĩ1ɺ1H5 lrff.AWAVAUIATIUS1IHH|$dH%(H$1HGHD$,HD$HD$`HD$DMtcM?L9|$tiMtdMwMt^IFAvH$H<$11LH5@:MuDHD$LxHL9|$uE1HH- MtbM6L9t$thMtcM~MtZAuAGIH11LfHMuHD$LpHL9t$uH$dH+%(D$,HĨ[]A\A]A^A_H=H<$LLIHB`H`H9uDHH9L9puHAv4A~01jHL$(E1E1^ZYD\$`ENDT$dE@AvDL$,E(IT$|LL$0t$xH<$DzfoD$0foL$@foT$PAFAN(AV8@I~HL1ɺ1H5?9@HLLR IIWHIOHHpH9HH;pHH9uH91HH9uLLLLK1ɺH5 D$,fInXIFXH9QL|$ H5DHuBL1ɺ1H5? 9HmH9tHL}AGIuH=LL>tM9tEEuL|$ VfDL|$ D$|H5 LM P$P1LL$Y^D$,EFD$,EtA~ uoLHupLD IH5P 1ALۤ1ɺ1H5# D$,xLLLD$,rL1ɺH5 47mAWAVAUIATUS1HH|$HT$L$$dH%(H$1HGHD$ HD$@Ht[HH9\$taHt\HkHtSuLetxMO11LףH5# HuHD$HXHH9\$uH$dH+%(ED$ Hĸ[]A\A]A^A_H=IHT$LAHL$@Hu4}0jE1E1ZYD$@ D$PD|$$EtH5ZLuhHHEt$\|$XDEVMLM W%H5 1Y^D$ H}HL1ɺ 1H5 L@LMYM~XIFXL90HL$pHl$8Lt$HH\$0LILd$(6HuHL1ɺ1H5O IHH9LcE\$I|$EuH=LLHtHAt$4E1E1A|$0jLQAYAZDD$pEt$tH\$0MHMLd$0PAF4L H5PAF0P1H jHl$8Ld$(H\$0HtHT$LHgHEDEpLT$\t$XDH`T$DtD$Ht{`HHtHHЅFHEHUHHMHHpH9ZHH;pFHH9uH951HH9uD$$HT$LHHL 1ɺ^H5OND$ A=H BHMPL 1VH5WL11-H5H D$ Zf.D$\ML IPD$`PL91ɺUH5~}L 1ɺH5QPD$ CLd$(H\$0L՞1ɺH5|$$D$\ML"~ :PD$`Ptt$\|$XHu t$\|$X0t$\|$XHf xgf.D1ffDUSHHdH%(H$1HaxmD$A%=@u'H$dH+%(HĨD[]Iٹ!1LJ H5 E1eH-8b;IٿIHhH9HDHH & APH5 LQP1E1H ?efH6H?eHHpHHxefHHHB@8AVAUATAUSLr(1Li(IHPHx IDj(Hp `t*HHH9t_@t?H9[]A\A]A^3et7@tGD[]A\A]A^fH9[]A\A]A^@HI9i1[]A\A]A^fD1DH֋Q0aAWAVAUATIUSH8H^PH|$Ht$L$$DD$ HWH1IHx^I9LBEHH@HLHxPuHD$HhpH}t0H}^HI9LBH H}uHH9Hl$E1L5--HD$If.E=Ht$H^pH{uUDH H{A;uL{HȽMLDL M9A9t"L1ɺB1LALML 1LC1AL]1ɺDLDHH PLς 1AQZYt$$L|tc;t[H[L\$(Ho]HI1IHLH PAD$D)t$(Lm P1L\$HALH D$ u}HHT$HHHVHELX PL1RMQ1uHUAMH0AEH,@IHHl$H}PHH8[]A\A]A^A_fMHʁt/w\H t!HXR@tHOH= HEH5HW H z HDH52$@H) tHlH HELL$(L 11<LLL$(HĩL= HD$HhpH}ff.@AWAVAAUIATUSHH-]T$ H}PHE1E1DHO[I9LBAGH<@IHHHPuIm`H}Pt;H1E1@H[I9LBCH<@HHHHPuM9MB\$ DLHLALh11eH5e)ADLH5HL[]A\A]A^A_IfE1IAVAAUAATU0SHH?0IHlfH@@ EHDmAl$HH‹rB Et$, AD$AD$At$(?HCpHxuvLJ}1H-o(L HH11L4H;LE1S[L]A\A]A^H Hxt;uA ID$ HS@HC@El$(AuCHHCHI$ID$HCHL LLcH[]A\A]A^fDHS`HteI$IT$L`LLc@[]A\A]A^fD1Lҁ H5i'[L]A\A]A^H:AWIAVIAUATIUHSHLHfH@HI9ttL)LAXHuLIHteL9LLHHFaHI>HKt}IFL3HCIFHI^H[]A\A]A^A_DH yHC1L u H5Q&H1[]A\A]A^A_DAWAVIAUATIULSLH(LnH$L$ dH%(HD$1HD$M}Mu^fDM}IMtKLWH9uHHLhUuHD$dH+%(+H(L[]A\A]A^A_fDA$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;L|$yDA$KDmL { LQHIF`HH{ LDʃtGH PL/ 1H5$AD;XZuE1DMT$:HH5$| PLa 1AD;Y^> [ATIUHSHH>;V1LHHHu.uHHHADHuI$1H9E[HD]A\fDAW11Lz AVAUATUH-#SHHH11L{ H11Ly H11L H11L H11L H11L Hf11LC HH11L} H*1L 1H 1L1HHBLy 1ɺ1HE11Ly 1ɺHHDH$IE$MnI}Ht!E1{SI}IM|HuM9MBEF I EuLd$L<$L- H;8 MwMΜII>M9wtH;H5DtM&LRH;LHcuH1Lٛ Lx 1ɺ1HHoyL%x 11Lkx HT1Lcx 1ɺH6H| L w fDHCHH1HPM1L Y^MuL1ɺ1HHʾL%x 11L~ HHAw L Pw DHCHHMP11HiL XZMuHHL1[]A\1A]A^A_%3H;L(HLHPHH0L2LH @8AH@0Ht3H t!HF@tH H(DHDHLv 1PHAw1I AVDL$(AH;LH NA?.L 1ɺ1HEHQu tH HHDhL| H됹H1L Ҽ/ff.fAWAVAUATUHSHHLn8 u:AL| 1sH58rHD[]A\A]A^A_úH5 Hu@L%AL| 1|H5AHE0E1E81LHL%t1H53u HL%ػtH5x H`L%pHEHU0L%L(LHHE0E8M@HC(L=1DH Et@HCHLH L>Q @ Q1DH1AHC(L%0_AXHSHx(Dr tJHx8tCHH61LPEN1LP AHCL%H DqDp Y^LMH1ɺAUE LP L1AHCLHA@ XZlAWAVAUATUSHH $HH $H(Dg(dH%(H$ 1HHAHFH H,U@H@HLdLMHPH<L5z H51E1̹H$ dH+%(H( D[]A\A]A^A_H;H5t ,AąDc(Au'H;H5" AąDc(@AHED@Dp(A@HcALl$MHAAAt AAM9LAKfDHW`Ll$L LJHsH;15Aą Lx 1H5+eA`>Ll$MHQLMD1Hmp LD$襟D$H;IcL>LDx 1H5޷fDE1M9LJHuH;1JAąC(tE1KJHLDHHPuH;1LAąLw 1H5!P@Ll$MHLMD1HDp LD$gD$H;IcLmDc(@Lv 1H5YfDHDD$ H4$GH4$DD$ HINVL9w 1H5;^fDHDD$ H4$GH4$DD$ HILsv fDL,v H5͵Lv 1H5afDH;H5; E1Ll$Lu 1H5 GjfLu 1H5>fDH;H5 fHDD$ H4$_FH4$DD$ HIDLu 1H5aMAWAVAUATIUHSHHHHD$L5m L= Yf.I<$H9sHHH)ŅI<$LtZI<$LtEHkLl$"HI)LCHHuI<$HLrŅta,DLt 11H5_H[]A\A]A^A_HFHHD$Ls 1 H5 F@Ls 1H5fAWAVAUATL%@ UHLSHHH?t4HEHH,uHS`@H;H@HHt1Qu=1E1Lr H5KHD[]A\A]A^A_H;LtH;H5 tHMHQ(taH;Ht H@8LADžLEr 1$H5߱Uf.Ht H@8.H;LNADžHHuHt H@81HADžHHt H@8H;LADž#AfHu1HADžL1ɺ)1H5kL1q 1eH5˰AfDL\1ɺp1H5dfHuA(>H HDH5nADžHE8LHU HRHRLlAEHD$H)IE1lIUAuHHulADžH;LADžsH;IL9t$H5jIOADžH;L4ADžyLo 1LH5*dH;LADžLo 1,H5L[o 1tH5kH;H5|ADžZ1Lo H5o$HE@(^>Ln 16H57qHMLn 1TH5>L}1ɺQ1H5LSn 1FH5cAUATUSHdH%(H$1?u/H$dH+%("HĨ[]A\A]DHI@uD$%=@tL-We M11Lf .LAL EHHH/H{/DHH}tھHIyD8 HauLi|1ɺ=LH?1LC|1ɺfL1@L3IxHg?f D8tbHMtCA}HIIHH 6mHDHPAPLyQPL1H ALzsL~{1ɺMHȫ@}HgIIH2H lHDH@APLQPrCL}l L12UATUSH>HH@HGHtSx.HPu ztx.tHE1Eu=D[]A\z.uzuHlGHuHADtiBH-8?Iٺz1PH3LzPH5zb 1XDZ[]A\"BH-kE18a?1IٺqPH2H58b PLz1Y^5AWAVAUATUSHHhH<$Ht$ HL$DD$HH/H=L3HD$L97E1M6EAL9uH$H8谚HD$HrEAODH<@HD$(H ;HHDIL9D|$8E11Dd$0EIHf.DI}AH@L|I?DHQ>HD$Ht$0HUHHHD$8HHAHAD9HL1 fDo HHHH9u*fDL 11Lag E1H5f.Ht$(H H=fL I L:g 1GH5zH$Ht$E1H8耪L  Lf 1H55o1O`L Ł Lg H5<놃'1L Lf H5Wff.HwHtHW H9tfHw HG@( tLs1ɺ 1H5v%AVAUIATUHSHH?~hLf HHcUIHH;DIH}#H[LZ裋xLLL[]A\A]A^H;Lը{Lf 1H5У[1]A\A]A^DLLH5k[]A\A]A^H;LuuLe fATUHSLMt3M`It$Ht% $@c1[]A\ @t*uHH;AEt1HtLc|H]~r  z \fTf/w1HtHC1\fTf/gHH;AEDI<$H:[]A\XHUH91HHCH9H HUH9rH;M1I;$HEH9!E~ _~ f(f/\fT)Q~ f/bA$f/w\fTf/Bf/1\1fTf/ef/wYf(~ } } \fTf/w7A$\fTf/\E1fTf/@Mf/\~ `} h} fTf/vyf]f/Mf/I\~ } } fTf/'1HHSf/wf(\fTf/]f/\1fTf/fDH HUH9rH;M1HHKH H91H;M@f(~ D| L| \fTf/3Df/ĸA| f/*f.HUH9t1I;$ 1H;@AWAVIAUIATUSHhH<$dH%(HD$XF<tgЃ;1E1LFX H5žHD$XdH+%(HhD[]A\A]A^A_@HnH^H9GL$$LHLEt HmH9uAAFtEAEfDI]AI9tD|$ MHL9InHSH9UuJ,Lk LuH$L@`rMM%xR(H<HML8 @tHEAEHPD$PH `c H$HL$PI@T$HD$u:D$T$f/v(\ y fTy f/f.D$ HEMeHPL(Ld$PHL `H$HL$PIL\$H&L\$Y1M9@OHEH0 `zL_ fH51̛D$ HnH^H9WL$$LHLe&HmH9uD|$ AF f.HELH8E @E PAr1L] H5D$ I} HEMeHPL(Ld$PHLvVr upH$HL$PI L\$H`L\$1M9)fD `M9M9 H$HL$PI H!1M9@HUH:WH|$ցQL] 1LH5bD$ gM91M9!=1M9 )Lo\ npL1[H$HL$PI H31M9`H$HL$PIH蟞1M9mf. `, NH$HL$PI@L$HD$-D$L$Yf/O\ t fTt f/1H$HL$PI L\$HʝL\$1M9L]  M91M9!\ T H$HL$PIL\$H?L\$r1M9D f/~s w*f(~s \fTf(%s f/f(f/\fT~s f/ aH$HL$PI@T$HD$gD$T$f/f(\fT r 1n@E1ADwR`H$HL$PI H͛1M9 RH$HL$PI H{1M9IfDL-6DLY YeuHt$I}L&L9OLDHH9uH ;HD$L9fH\$HLt$ IL$L|$(%2LIuH5&u,M$$L9M|$L'HLH;BtH\$L$Lt$ L|$(@N , uwH$HL$PIH X1M9 \ p fTp 1f/1M9 LX  iH$HL$PI@L$HD$oD$L$f/f(\fTo 9o f/o"f.HD$ImHHD$HH|$H9|$IEDmL$(L|$8H\$ HHLt$0EEtnHD$AL`L%I AE9wHDHHL;hu0LLH$uH\$ L$(Lt$0L|$8@\HD$HHD$H9D$uH\$ L$(Lt$0L|$8LU YH$HL$PIH41M9H$HL$PIHʗ1M9H$HL$PI@L$HD$茗D$L$f/ZH$HL$PI@L$HD$@xD$L$f/f(\fTm  1M9Ht$MEH>H|$ H9HHH9uMH|$ %@D$HH9|$#A(Ll$(L$LLt$8H\$0L|$@ALfA9HD$ AAL`L#1HDHHH;Xu+0HD$(HLL$H0!L$EDDAE9vDHD$ HHD$ H9D$qD$HH\$0Lt$8L|$@f(f/~pl \fTw nl f/f/\ Nl fTf/xH\$0L$LLt$8L|$@Ht$H9uHH9HP:u\ k fTk 1f/HD$ H@8@DuID$8MWHIH\$L$Lt$ L|$(#'|$Hvff.HG(u LGPLOPM9tHG@H@H9t.fDP(uс t P(HH9uM9tI@IHH9t>fDHPHt':t"HpV(tV(f.HH9uMH1TLDS H5p1HAWAVIAUAATIUHSHHtZ!H H]HtCDX uM<$Mt<Et DA#D$tLI LHHHt,IM<$Mu1MtI.H[]A\A]A^A_fDMtHIAD$H[]A\A]A^A_fAWAVAUATUSHH(HHHnEvLOH;+HH9C){,HvuIF`SAN(HRHHHPH0HDЃIiI>1LܟuLLI D4$H5H|$HH@0@8LIϋC(@JHL 1LA H5nL%WL@ 1H58r}H$HH@HBH/H;t:HH0L r1ɺ1LrLL%LO1ɺL~H=Iv0I>1juLLG D4$1H5[DH-D1ɺ1LOHkLO11HME1L%LE 1DL|H 1LL{XL{PYL!F H5~uLD4$H;H5gY RLvF H5H~t$LD H5"\~D $$LD H5-~D $HL pH5HPHH0H*HIH 1ɺH@0@81}H;H豂H|$jLLE D4$H5^}LL9E D4$1H5(g}TL6D H5?}JLCD 1H5} LC H5|LLD @H5|LL< H5]|HsHt H;aC(HS@HK@HCL{XL{PH9trrHH9uC(l HD$Hj1LC H5 |HD$LL1< 5H5{HCP0AWLC AVAUATUSH8T$(H $Ht$Ht-D$(HH<$D$/uCt?LC 1H5J{1H8[]A\A]A^A_fE)uH}@lIHf@@ @0H}InE)OIFAF0IFH]@HD$IF HE@HD$ H9CHH59 L @HT$IN, MeLuM~8I_H58 L'LLExHuLHAUPzI~HD$IIF IGIF L8HM~ H;\$ &H}(jIHfH@ @S,&Le`H|$HXHC Ld$PHthKL IIO, AMHADDm8H}ILljHL1HIF(~DHEbCH|$H@HLdM1L B H5yH $1HtAV0H}L$}$HHtfHpHt]HT$HuLIV8AF0Ht5HBLExLHHu@H@HH}PPIF8H@@)tE(@t7D$(t/H}PHEPIHEXIFHEXL0LuXE(H<$HtAF0|$/LA f.LAA 1H5wfDCH|$L@ H5[H@HLL1wyIF(L A 1H5SwFH8H[]A\A]A^A_h裶AWAVAUATUSHXH|$Hl$ HHHL$H1LD$dH%(HD$H1HD$Lp L L-L`I}PL1B@LLLuK<'Hbt/CH<@HHLHPLHL3uHD$AHD$HD$HdH+%(HXD[]A\A]A^A_ÐALE11 H5ufHD$Lx`IPH@h1HD$1>DLLL uK|%Hyt.CH@HHI|Pt?HL$HL,LKuHD$AHD$f.E1 AWAVIAUATIUSHxT$ dH%(HD$h1DL<,u!AFI<,tLAFIt<,uLH)H$H$HL$8HLLD$<"t<'TIH$H$A LIHL$L$LM)LD$@H|$PIwHD$ YIHVHT$ Ht$@HI9IFHDŽ$H$HD$HDŽ$HDŽ$HHDŽ$HDŽ$HDŽ$IDPL$` LL*H$`I€9-cHL)H 'H&HLпdAHHHHHLп'IHHII@H HI?HJcDH9kEɸ$DDAA$HD$D$HHuHQHtDP uHDPLHϺ DL$@HL$ HL$ DL$@H$`I>:HeH)Hn$HB$H$LdD$8HHHHHL'IHHII8$I<#H<#AD$HD$D$$HHuHVHtDP uHHDPW+=-&"D$ H~L H|$@H$`H|$@H>:HH)H$H(HȿdHHHH<HHiDT$ HHkD$8H$L$ Ht$XL H? HcH>Az A+L$MH$L$E1E1HD$(ACuH$H$LD\$@DT$8DT$8D\$@HIy8%vH|$0@L$ 1HD\$@H$`LDT$8OH|$0DT$8HD\$@HwL$`A@D \$AD\$L$MIH-LT$L31ɺpH1cLT$fIL? H5`cLL;? 1H53mcD$ALHl$ML1. ^H-1HcLT$ AH|$HDAFIHDQ u<[L<(4~iA 1LDT$8H$H$臑IH L$DT$8E1E1H$H$HD$0L$HD$(y<"t<'uI~H$DT$0A H$ DT$0HI H$E1E1H$L$L$HD$(HD$0I$t&H|$HID$ItDB uH$H-zL EuIm`Me@IE@I9T$ DM$$I9E9T$,uA9T$uD$ H@HHDHD$D$A#D$(ILD$8H8 RHHqfH@IH8QHH fHEMALD$8SIHL$@LD$8H8QLD$8HL$@HNfHAD$LeEAMguMd$L$` t1IT$ LL$`H0AԅL$`HT$(L)HrD$]HHT$}HT$HH$`nLHHT$HT$H$`ILeH8.I$H$`HEH8g I(H8kPIHaH$fMd$AD$ID$ Il$H0M$$AD$}<{kI~9L1 1H5^3H$HD$0Ai1H$AHDHD$0JILV: H5U^)@]6Hl$L .1ɺ\ H-1HL^LT$H1o LT$L, !^LT$HDŽ$HD$(Hl$* L + H-LHH1]LT$HDŽ$Ixt$ DLLD$5LD$HID$ H@HDA EAD$ LT$LL$ LF, H-1H/]L,1ɺw1H]QHD$(Hl$L>0 P LHH-1H\LT$1HDŽ$L_,MLT$LHt$8HT$(HT$(Ht$8H9HGIH8HT$(fMHHT$(LHiH$`ID$%=n @uDLuM}A$AAtAD$IFILH8`SuHEM/L AtIT$H@HD==6Mt HEI$HAIT$H@HT$|$Le}D$%=D$LeE1Ed$NH-¼1HLq- ZL*11{HZLHl$fML$ >qLL$ L- KHL$8fHHAH1ɺ L)H-׻1H ZLL$H1L, YIHH8^D$ DLYH@HBHrLHH-ZL@( 1 HAMA<"t<'l11H$H$LDT$8A $ *DT$8HIH$L$E1E1L$HD$(IH|$0H|$P DT$@HDŽ$HDŽ$ IDT$@HHL$`LH@LH=m;@DT$HHD$@L$L\$@DT$HA<"D1<':L$ H$LDT$@A LHL\$8L\$8DT$@HIM H$ H|$PLDT$@H$L\$8lL\$8DT$@ Hl$M1ɺ H-L`'HWHD$(LT$HXH|$PLLT$L$g\LT$LT$IٹLF$  }LL$HL() H-1H4WIT$ AHLWHRHIU`HL y H LDHL R H-1HAA^Lx& A_LL$H1 VLHl$5CL/ IE`LHH|$0H|$0fHEHL%1ɺ LHl$œML XIHD$(Hl$LZ ^ LHLuM$ I$IAIT$IFHH|$0HD$0t$ E1HHEHIJ[HL& pH-1H9UNLuM I$IAIT$IFH Ƅ$ %A#I1LL$HHDŽ$`L}' kA@HD$0HH-O`ILH-=LT$1L$1ɺ H_TH|$PH2YHD$(LT$HXLT$Iك_ Lm" ALL$HLl$ L H LDHL&# R =DMfD$HAFH$DT$`L$ H|$XMHl$@LILH|$HEHHDQ u<"t<'HHt$XHA L+HH+HtH|$H HEHtDB u LHH=5R t}T$HIDT$`LIHl$@9 IMH5LHMt;PuH-ZLT$1Li HyRHD$(LT$HXSJ H$ H$HH|$P趌m H$`ELT$@IIH\$(LT$ L% HIH-1HQLT$-1vHl$H-v1L Lt$ HQL\$HD$(LT$L$HXHl$ L% H-H1HQHD$(LT$HXHl$L 1ɺ H|$0 H|$0HMHGDHEt HAHWHIt$ E1V?HLl" gECEu1|$HDACH$ H|$PLDT$XH$L\$@L\$@DT$X IMLT$H- 1ɺ LH10PHD$(LT$HX|ICH$H$I~@DT$@HIrL$L$DT$HLM)LD$@H|$PIwHD$8@IHHT$8Ht$@HI9IF)1 LIQDT$HHqH|$0HGHGH|$PLDT$8E1TD$DT$8E1L$%D$H$HD$(9Hl$H-1L H}HD$(Hl$HL 5L HA LEH3 PH-G1H|NHDŽ$Y^LT$uAuLпdHHHLпHHHHl$L L H-H1MLT$iACHD$0L$L$LH\$(Hl$ML( HILL$BH|$1IA<$"A2 H|$0HMHD$0HHfH*YY) t$ E1@ID$RD$IL$`HL1ɺmH-1HLHL. 1LfLL$AH|$1IA<$"AHMff/f/( Y( t$ E1,HHIQL$`HL= fHD$HVHDP H)HG D$ H~D$ HLHQH)LHHD$HDP J L)uHl$L L ]HD$(H0L 2Hl$L WHA LEP@ Hl$L1ɺ; LL$H|$1 IIHu A<$"Let$ E1 ILPM $H:Lr RLt$ E1LILL$ZPLL$HL ( HD$(Hl$ Lm H-LHF蘉$0 $4H|$01|$8DD$(LL$@H|$XDT$ !H|$0HHGH|$@ H|$0DD$(HPHWEjD$xDT$|D$ cHl$L &H)AHVI)HD$HDPJnHDŽ$HDŽ$Hu@HVHtDP uDL$8Hl$L L Hl$L1ɺ} LH-1HHLT$L LT$Lcب^LؿdHHHHJ$0bHl$H-1L HH$LHT$(H$LaDT$ HT$($tH-D+$H|$0HH)H)HoHW1A?"Hl$M PH\$01H-nL" HHSGXZLH|$PoLLT$AH~ LDL$`HL$XL\$HLD$@H|$ [H|$ L\$HH$`ILD$@HL$XDL$`HH)H)€>:JHD$ KHH)I HD$81U$$:$$$ :Ճ$ HPH-XL HFHƒfHH H*X(Hc$0$,$4HуHl;t$,$($(LT$@I H-L ILT$HEHD$(LT$HX LT$@IIW|$HL$`AC M3ACM9dME1M?AM9uDHFDD$`HrH<DT$XL\$HHt$@Ht$@L\$HHDT$XDD$`HD$8 ƒL4M6M9uH wL\$HDD$@DT$8H|$(L\$HDD$@1DT$8H|$(M{M;I>HINHL:HJINHIVA9wL\$8DT$(L\$8DT$(LT$@IILp LT$H- H LؿHHHHl$Mރ L_ iHl$Mރ L| 댄u@HVHtDP uE1E1iASHL t$L$p_H-M1HCAYAZLL$HLr HATLa t$6L$pHLA UIt$L$pHL1ɺ{%IH\$(LT$@IL HLT$IIMHl$L L Hl$L Lv LdD$8HH1IIIwD$81E1Hl$L Li /Hl$L1ɺ LH-٣1HBLT$LF LT$H~ LHL$@H$`HL$@HHHA|1Hy LLT$HLL$@H|$ H|$ LL$@H$`ILT$HHH)H)LȀ9-HD$  HL)I*HI@H AeLпdHHIIAADHl$L1ɺ LtL^ LDL$lLHL$`LT$XLD$HL\$@L\$@LD$HHH$`LT$XHHL$`DL$lHL)H)HD$ BHl$L1ɺ L^HyL LT$XLD$HH|$@E1H|$@H$`HLD$HLT$XHA-HLH)H)HD$ ff.AWIAVL5"AUIATUHSHHdH%(HD$11HHLH$IHH3HLȱu\Mt*IIGI$IG ID$IG L Mg MHD$dH+%(HL[]A\A]A^A_Mt3IIGIW I$H,$IT$IG L Mg 4I(H8/IHuH+E1HDfH@@HH@@HIG IG^}@AVAAUATIUSHHHdH%(HD$1H$HHuHtH}BHHEAMtA<$tH5 Lu)HD$dH+%(rHD[]A\A]A^DH(DpH8h.HH fH@HH@LHHH@@HE HEiHL,$MMeEHMeIEnBD` uL%1'LL@ <L1M(L8 <L1L )<)L 1ɺ#1H5V<HHE1H8!A@H?-IHfH@(H=e H{IEH L%L 1L;HHtH;@LK 1ɺ1L;6@HAHhfHǃu1E1L H58;zff.AWAVAUATAUHSHH(dH%(HD$1fDI߀,u SH,tI߄CHt<,uIM)M+LA@-HL$LD$LHAL%1ҾHqL,11L濄5:H1AWEL L :X1ZHT$dH+%(H([]A\A]A^A_@E1L%oIwMVA@M3L%mL 1L9*@IwMVA붋T$t$LaRt^HE@HM@H9uUfDHH9tG;P,u;puEuP( uFM8D qu8HP()LE`EtBHvHA EHv1ɺnHH5MLL 18랹HLD$t$Dqt$LD$HYL%FL'1ɺgLo8DAWAVAUATMUDSHHLnH$H|$HT$L$HD$(H$HL$ HD$H$HD$0dH%(HD$xH;HPMHfDH Hxt}8y1E1H-dLJ H7L011.Hv7HD$xdH+%(XHĈL[]A\A]A^A_DYIH(HD$HL$Mg0AW(I_pIO` MwxAGAW(@ t}t AW(tIO@AW(IWPIWXIWPHG HL$8IOHIO@=tHZ)MPfIW H=*(vIHHIG`1xHPpH`HHvzuH&'IGhHH$E1Ll$LLHl$P$HChLc`IN$IFL;4$IH{`O$vILLLLHLHct$LtHH;L`L&HH A^AEtEA$HChJ^fDHxHtAąH'Aąt`HHL9t%HHx(u@ HHL9ufEvMAH}HD[]A\A]L1ɺ1H5)@E L%Ɋu"L1ɺh1L(E L 1ɺ1L(m \L\1ɺ1H5d(:fHHu2HHAIHtP-u߄tHH-tHff.G<wHb HcH>DHD11L H5Z'UH@DfFf.Rf.Sf.Af.Uf.AWAVAUATUSHXH|$D$$HD$HxH|$HD$ HD$LXMcD$MKAM/E1IIH1LyM1MoAME1ImH1LeMtmE1I|$HtJDD$LT$Ht$DHL$8DT$@LL$0L\$(DD$LT$Ht$DHL$8DT$@LL$0L\$(Md$AMuA@HmHvMmAMOAMDM%HIHMIAMAM[DT$MD$H|$D$ HH|$HkD$ H|$D$$HH|$H%D$$HX[]A\A]A^A_AWAVAUATUSHX?H|$ D$HD$ H@HD$H8D$HD$LPMA:PD$MBM{A8&E1IHHE9E1HYH;1LcMA<$E1Mt$MA>E1InHt{}t1H}HtQD\$LDL$HHL$@T$iAEMd$MtA<$2ADH[Ht ;AHIHt 9AEM@MtA8AD\$MRMtA:eD$|$|$HD$H@HD$Ht8D$|$|$HD$ H@HD$ Ht8D$D$HX[]A\A]A^A_AAA,A;D$KD$gD$@AWIAVAUATIUSH(A:~MJM=A9FMAMA8IHH9LqMA>InH}iL}MA?1MoMtjA}I]HtM;H{Ht2LLT$HL$LD$L $LT$HL$LD$L $@H[HuMmMuMMvHmHRMvM.HIH M@MMIMMRMH([]A\A]A^A_@A$MmPA$C M rA$MPA$AE MVA$HmPA$AG H;A$MvPA$E M[(A$HIPA$AF H$A$M@PA$A MA$MIPA$A@ MA$MRPA$AA M}A$PA$AB H([]A\A]A^A_fDL rE1MMH9t:HD:uHIAH9tuAIAt!A uICD 1ff.fL  HoMH9tED:uHIAH9t;uH  o8uHHH9t4uE1Dfu1H@AADE1u̸fHLhrH9tH:uHIAH9t3uH F -8uHHH9tu1Duuff.Lu eE1MMH9tBfH:uHIAH9t#uAI At)A MH9uDuKRAD1DAUATL%) UHSH>wIIcL>LfI\$IfDHI9tHHu1H[]A\A]ÐHNHEHH[1]1A\A]DH^11HH UtHsffHv[H^E13Lct#DHHLwAD9+wH[]A\A]@H^ tLcE1DHHL/AD9+wfH^tLE1DHHLAD9+wx@GE1;G sHWpAwH DfHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$HD$dH+%(uH譳ff.fATUHSLgHMtID$I+$H9}?H臬IHt9H@LI$Il$HCID$LcL[]A\f.HGIL 1!H5 ff.ATUHSH9tCIH1H0fD0HHHHPI9tH HDNu[1]A\1[HU]A\ff.fAWAVAUATIUSH(H?LD$H9LL$H|$IHI膭H|$HIHfDHH9t HDB tH9toLHAADŽt?H9tIU @HH9t HDB uI$H(D[]A\A]A^A_fDHT$H|$H5 1PfDHT$H|$1E1H5 -ff.ATUHSD&HHvAtIHuPHuHtHHcCHSHKH,AuHcC HS(HK H,[]A\@HtH}t HH  XH5S H= ;ff.SHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$gx'HcH9ںCHT$dH+%(uH[øAWAVAUIATIUSHH8H|$dH%(HD$(1HHD$IƽL|$8f.L&CIHcH蓨IHD$Ao$HMMID$HLAIGb9s|$-HD$L0CHT$(dH+%(u=H8[]A\A]A^A_L`HL$LHHt{tخHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HT$dH+%(uHff.HGuoHt]HH\u"t\u߈QHqHyu;HHH~t$\uN"t\uHԐ@LGHE1E1Ʉu,TfD<:udMɸ:LLDɈHLGt*<\uG<:t<\t<@t\LfDHHtLHtLD<@uMtLIʸ@AUIATAUHSHH(dH%(HD$1HD$HtH;ЧHMHHDHunEtu5fɸAUuV2w"H  HcH>}t1HT$dH+%(.H([]A\A]fHt$HH9l$t1 HD$wL$HxLfH*\fT fHl$ f8EwHU'HHfHH H*XfAufHtHH+ f(fTp f/HDHƤ~@@B뱐fʚ;fHd @HqHaVfDFfD@6fDH!HfH*Y { f/s H,\H,H?D}}ufDUwUfSHdH%(HD$1FF F0Ht^HH5 H\Ht'K8HT$dH+%(H[]H5 H!HtIHHx 蟏Hu H脏Ht&L`HT$$1H5b LՈAŃL%u1ɺn1LL4L H1UL LXZH$E1HHD$(dH+%(H8D[]A\A]A^A_þ LĎHD$H]HLIHH@@fHI)@@ @0臊LLIID$L9LHFHT$EHHHT$HD$HHL`< LIG(HD$HHcT$$H+D$H9 D$$HcLHT$HT$LHD$HrHHT$LT$LHL9IG踒H|$IOIWIG0D$$H5B HAG 1IALJA LEHHuL1ɺL%s1LL Y |L1ɺiL%Qs1LL Ls1ɺrIG0L[1ɺL%s1LL HLL 1UmYL^L@VL1ɺIG(L1ɺvLϾ HT$LL$LL$HT$HILLLL$H)HD$Ht$LHD$LT$LL$HtHT$LHHL9IG躐I|$IWIG8L%o1LL1ɺAL 1ɺyH$L8HcD$$HL$$KPI_0HH)Hc1ɀ|auT$$HH9uA;O sII_I;_Io8H5H蹄tH5H覄HI_Io8H5HxtH5HeAH Ht4 _HHu7IG8L1ɺ 襋1IW@L藃L L%npxff.AWAVAUATIUHSHH(dH%(HD$1HLhHHILH5 Hǀ1HH)HH蟇Ht:AM<$HT$dH+%(H([]A\A]A^A_fDH5 HQHtL-g1LJZDLA 15H5gE1eH4@HHID$HT$4IcH 2 E1HL$L4;uZfHcD$,AID9|$4vEID$DHt$MLHRH1HJHztL*1ɺKy1IT$MLH5U LytL1ɺOB@HcD$,LH5 M<HD$0HD$HL1yt/L1ɺSfDL$ DHcD$,1INjD$4t-IL$T$A<H4@L4sT$A9T$4wӋD$0Mt-Pu 7Lxr- LT$vT$HuL 1ɺZXL H5 yHT$LH5 AIG ELD1LxAtL1ɺbHcD$,Iǃ|$0 LDL$~IHILLL)HD$zHt$HHD$DL$HHHT$HD$LDL$HH9HG胃D|$0DL$ID$ HAvH5ADL$DL$t}D$4AD$H$L ~Lȶ1ɺmLHDL$DL$HID$ uL hL qID$ h4AHE|$(Ik ID$0HE1H A|$(DL$HD$u?HcD$,AIAD$(D9vjDHt$MLH@ID$0DL$D\$HHHHP1vD\$DL$tLõ1ɺLd z1ۉIT$0DL$A<H @H,蕽A9\$(DL$EwATUSGH(pH{)IuoHWMC+&fH;HSHfH@@@@ L`I@0HDLY 1>H5. E1L[]A\H/HHIHH@@fH@@ @0 ;ID$HHsHxA$ID$ID$HHwH/C+?*|9HiHH%H;HHL`fIH@@Hh@ @0L[]A\DLt1ɺeE11H5 L[]A\H;HHtfH@@@L`I@ @07fH;HCHrfH@@@L`I@ @0LHfL1ɺ43DL1ɺ|DATUSHIHt{|tL[]A\fDHHHHtxH;HHt6L`fIH@@Hh@ @0L[]A\fDL1ɺ1H5i E13hfD1E1L H53 5ff.HGHG0G8HtHHHHH@H9s=HLG(HF IPH9LBLnHt1HHHHHÐH)HcH9|1HÐAUATIUHSHHLoHu HHtHHs0I}HcIEHH)H9}YLC(HLHH9wqLHE1HtIC8HKHƒH#H)HHS0HIuH|HCH{0H8HL|Hk0AHD[]A\A]HH]ff.AWAVAUATUHhSH8H|$T$dH%(HD$(16IH HxHHHǀ`H1H)hH(CI1ILt@I?IrH\M9uH|$HsHD$H D$L|$1Ld$L5@ IHŐMLE1LH1yHIA9vA|IHH9uLd$H\$(H>IHfH(@@HH fHH@ @IEHD$LLt$$M} IELLh HtOHl$HD\$$LHD$$HHuLl H5 1\H|$L/L 1mH5 *f.H|$LE1HD$(dH+%( H8L[]A\A]A^A_f.HHD$IID$8ID$0I}Ht%MmMuD}A\$A 1҉\$II}HtMmM A}u܉ڋ\$AT$ ID$$At#I{HtL蕺M[MtE;Au݋D$$AC H|$HID$HAt$ H|$HID$(HHLE1ET$ELH1kI|$0D8E|$ HC0EAAIHLjHLH1kI|$0D8E|$ HC8EAAIHfL#HL1HmkD8HAD$AHK@A9xE|$ IT$DI|$0EHAAILHH HC0LV1ɺmH-a 1HL111HwRfHC8L1ɺoHC@L1ɺqFtH[D8E|$ HC0EAAILtHtD8E|$ HC8EAAILsHHlD8@AE;t$AHl$AD$ Ml$0LXoHYfH@E1At$ I|$0LhI$H0I$PHu2>DL1HsiHKL@II9A\$ I|$0McAAAILHtdHuKD@Lm1ɺH-x 1HLH1ɺ1HifrHHtIڋ\$IEL MrHt"L1ɺm1H5 L1IDŽ$HH|$IH"HD$WLL1ɺ}1H5 :Hl$E1L AD$@IT$DH‹HkL{ IcL>fDHu0HC0HxHHtHu8HC8HxHHsC$LH {AL$ I|$(Hs81A;L$ D#tLK0HHP@f.ED HufDHM0DM$H{0EkIw0 HuEG$IW8HK8EHu8fD< <AE;|$rI|$8}IHHxHHLHǀH1H)HM,$HE0I$HHpHU0I|$0L&I$`I$XHAt$ I|$0^)I$@HH- L1ɺ2HMnAN HID@ aLLHkHt63H@uQfsH@t;LH8HHuD$HT$dH+%(u#H[]A\A]fDLHiu?fDHHt/ЃtBuHt HuDøf;UHn HSHHHcH>@H[Hm;Etf1H[]HuH{tHuH{H[]HSBuHMf.9uHuL՟1ɺ1H5J bf1ff.fAWAVIAUIHATUHSH(dH%(HD$1Ht$b(L|Mt)LIH-fH@ @hIHL9a cHH@HI9CHEB uHl$I9,HfHI9t HB tH9HHL$H)MLHL$I$HI9t"HfHI9t HDB uHl$IL$MLL HHH\$qu51M"HT$dH+%(H([]A\A]A^A_IL$ MLHLH|tIL$MLHL> HtIL$MLHL% HͳXHNMLHIL$L H衳,IL$ MHLL H|L9|$MD1H5r Lg1I<$D$S`LK`D$HiHL$I$HCH5" L1Hl$H5k L1hH5E L1RJef.AVAUATUSHH $HdH%(H$1HH1Ia)ʼnHT$1r,\uud8IŃtHHQLaM1ɺPH LPH5֭ 1E1_AXHt$aHD$@HD$L$L+]HHdmvdo001H9$ML 1E1H5D 7[H$dH+%(HİD[]A\A]A^DcHL8E`M1ɺPH E1PLH5̬ 1AYAZfbH8_M1ɺPHLAPfDD$$$At4Lլ H5T 1E1tjHA1RH5 E1L JY^A}H50_M1ɺPH LtPL$L$L+$I HD$IH9vSHPLE 1H5t E1XZ!L$L$fD1LΉdcHx_LZH'L$A)wjL$H$M9tkH"AVL$ Z`H8 ^M1ɺ PH(+LQPL -HAt\LD$XHoLD$HCELXH([]A\A]A^A_@LFH([]A\A]A^A_A$LnHHATIT$HIt ttAE@IM)D9;LF_fD9LFFfHvH(L[]HA\A]A^A_fLnAUAMA8 $LL)9Fʅ;λDHÉH9tA|HCA8<tֿLD$HL$H)މT$VT$L$HLD$I)ItHxLD$PL$1TL$ILAoeLD$HA&AMLAEMu1LD$OD$fDLnAEHIT$ItdAMA4$HAt AULnAEwHIT$ItAMA4$HAt AU|LnAE0t{HIT$ItSAUA $AT AU4LF$LF 111LD$TLD$HIt1HxIUHIL*ND$LsCfDLD$TLD$HIfoS 1@@@$@4@D@T@d@t1ALADAoTHAHHuA$IT$LHIADD$GL!MD$Ls:DLD$SLD$HIAELHIT$IvXAFAoeA$AfAomAn(Aou(Av8Ao}8AFA~H,D$zLxLD$LsLD$pRIHHCLD$IuLLHIEnLk;ELD$IwRIHpLD$DpHxLLL@TLkEHLD$L$T$QIH#T$L$LD$HIuI}LD$T$GOL$o+LD$AMAnA$IT$LHIvAFALs3LJD$!LJD$LJD$AouLLD$pJLD$nLD$JD$LD$JD$11111AUIATIHUSH]PHtWAmIuHxHùD(HJIHIuH{H@1ILII\$A$H[]A\A]H CH5. H=y rGfATUHSHOHt]IċE11A$L/w!Ho)AT4HBD&HHuHPILc[]A\H J SH5 H= FfATIUSH#OHtpHA$IL$1HULE0HHL9t+to@2HHH/L9uLHHk[]A\H iH5ۜ H== Fff.@ATDbUSA9tq)HHLH֍qHHHH|=LL1rHHUHEHDHH)r1H4 9r[]A\futEt1fDEDff.fAWAVAUATUHSHH9tw)IH! HcH>O1H[]A\A]A^A_DA$LnIT$HIttA$HATA]SAU0HLD$D$LnLIu0rEMEIUELD$HUFD$BfDLnHL)AUH9#1DHH9kA\A8tf.LvAA$1H9AA8T6uHMnIT$LUDHA|AD9hBA@LvASA$1 HH9=AA8T6uHMnIT$LDHBt2*AD9AHLD$D$@LvA$E|EA/AIIT$HHHDHB2A$IAD0IV /w A8s HH9uADH߈D$APAwBHLD$LfHGI4$HtH AoD$LEDH[]A\A]A^A_f.HGHvHtH DLLEEEEuELD$CD$cI~DD$2ADLAD$6LD$fCED$I~DD$ADLAD$cIHH5 Hу8w(HcH>ALHHA|OLH@HI9tMu@HxIM)DOM9|E1 HL9D\E8tDHxDEtE1@HA9|D8TuHIHDL92ZfLHA9BE1fHH9$E8TuHIIDL9HxAT/HIHL9@MHL9@IIDL9rfATL$LOUHSHL9tHtLL%IHIL[HHL]A\AULOIATL$USHH/L9tHtLLIHMHLLHsA1Et 19+DH[]A\A]UH,HSHHH9tHtHiHH1H9t H[]Dt!uHGHHH[]fDHGHH[]DUHHSHHH9tHtHHHH9t9?t H[]fHWH);Zst1@ 8LuHH9uHHH[]@AU1ATUH-VSH\$;HGH HtEIH H5HǀPHH!I#$A$H ID$HH=ID$PID$HI$I$I$I$@I$HI$@I$ I$I\$xI$(I$ HcI$I\$xHWHHHt&n>HHHA$M$hH5 LDH=?lBHHt1HLnH=֗ ZBHt<81u7xu1uJ~A$A$hH= I$HH=rID$HH=L I$GHL賎L|L BI$8L#}A$htHL`L&I$8LI$8HLLo-&L I$h"H\I$H1L羟Li,vFLL I$A$I$I$I$I$I$x1ҾLHH 1ҾLHf1LHH HRL4HI|$x+ I$HHPI$HHP(I$ID$pI$ID$h !L͐L]KL轜I$Gs1DH<:H=MKA$GHt&:H$HHL L\Ao$HAo$XI$GAo$hAo$xI$GAo$Ao$I$GAo$A$A$A$A$A$A$A$A$LH-8L Hk4H1LŽ K4>fD1T:I8HI9 7I$GH11h1H5e (e3DAWAVAUATUSHH $HfHt$HIH$HL$ HT$LD$(dH%(H$1I)$HH=P-HD$HdDH|$6HEx.tL`H P1L$MH L蓁H5 L4HHHD$H\$`LH@HH,HWIIFH3H3CH uIVIFH3SH3CH uL,ILpLoHLLHIL= HLd$0f5fI1ɺZL1L )D$0)D$@D$P#'H.H@L+HofAofAoVLA) $A)T$+H t+MLY 1Lb1&fLHD${L 1ɺ1H5 o&H108L-1ɿMPHhH5͠ PLh1&Y^H|$4Hf.H|$E1H2|/8,L2h1PHD L %NPH5Q 1%_AX:fDHD$ {H0H|$A1uHD$(HH$dH+%(HĸD[]A\A]A^A_HL M11ATLH H5 %AYAZ.E18+L IM1L7gPH/PH5_ 1$A[[M/W.8+M1PHgLPLf1w$XZMLK11H5 L$ATH1IUHH~HSH)HHdžH)Lc1A?fDH|H0HD~@ADA HI9uL[]A\fDAWfAVAUATUSHt$0HT$HL$LD$PdH%(H$1HG@)$HDŽ$HD$pHNt$@!t$$ t$88 D$Zt$<h t$DD$\Ht$D$4HHHT$H9=HXT$8D$LI T$$ T$@ E` HD$t$@tHHL褁YL$Hp D$D D$$D$hD$lHL11L|$lLt$hLc H5{ LLH[HH1H9t@HH9uf D|$lLLt$pAEw ZHtHHt H9L AW=L AV11ɺH5Ǚ #_AXD$LD$8M D$~IE@HfhLH5 1U!D$LDHB|$Z7A =ǯLk H5 11;D$[DD$$EtH=# fDHTHD$HH9D$MHXHT$HH,@L 5@H(H5&! fAB u)IBE1E1LH=LLHHAHtHHt H9# L =L .H5— 11IGL1PhHD$DL$@E1HLK~A HtHHt H9L xLي 1zH5=  HA7HpH9gLH=­L TH5ޖ 116D|$0EAHtHHt H9 L =XL 11H5p HD$HH9D$fH$dH+%(D$4Hĸ[]A\A]A^A_HHHLPH1I9@HA HAE1E1fDA HAHH5H9,LH=YL H5u 11HD$LA H HH H9 LH=L| 7H11AVH5 X_AX8L AH5ϔ 1$D$4H'HHH9HXY=@HA1SL H5\ 1[]Ht$xH{0HA Ht H9L -=ΪLz ?H5 11B%DHtHHt H9:Hۊ=mHA1SL H5 1A\A^f.HtHHt H9H-s.=HA1UL H5! 1{AZA[XfLt$pD$8MV D$L#v 1ɺ1H5É HtHHt H9HHT$(^=OLc~ HA1AWH5e 1AVHT$@RH D$L6HtHHt H9"L=DAV=ٟAWA1LC~ 1H5 MXZLSI}LxL#qIHtLLH-II}Ht$PLyD$8 D$ MLp 11H5 q D$LLK1ɺ1H5C ATUSHHH HxH$L $H$pHD$H$HD$H$HD$H$HD$8dH%(H$h1HT$ )$`HH$`IHD$(L9h E1AHLABELONEH9$`H;$hH$tϦ;$p$t xHLVM2 001H9$xMt EtA1ۅE$H$1D<-tHcD4@HuL=[ Low 1ɺ1LQD$4H$HD$ HXH L$1L%s[ fDIHD}I>"DEtHALw 1S@L1YA6AL/w 1ɺB1L^AvL0w A1LD1_AXl@L=Z 1ɺ1L!v LY\@L=Z A11LLu &$t  fDL=\Z A11LLSu E$HMfHH+D$ HD$(I9t$ALv 11]H5Y E1I~L=Y EL$ZH|$IHIH=H=@„tHHIHAI<$Eu)I$ID$EtH|$Ht$HHfL$HA1SL v aL1AXA4$ALu 1ɺc1LAYAt$AL u 1ɺe1LzAZA[L$TDEHD$8Mt$DEH|$(HH+D$ HDI9t!Lv 1ɺ1H5tX HI|$Il$AL5HX HAHH}t}EtHELu 1SL1_uELu 1ɺ1LAXuELu 1ɺ1LjAYAZqEH$hdH+%(-D$4Hx[]A\A]A^A_f.L$HLPALut 1ɺu1^_L$@1H|$@of\$4L= W F@HL%V E1SLPs NL1XA6ELr 1ɺP1L`XAvR1ELr 1L;XZ`@HD$ L=wV 1ɺ-Lh LLH 1Ht$` H$H nh 1ɺ.LILgh 11Lgh 1L$/L$HL=U A1SL(r L1\A[A4$ALq 1ɺ1L6XAt$A1ɺ1LLq Hk HH+D$0HD$8ZYI9tLs 1ɺ1LI1L1Lg EL$1L1L^r EL$1LLjg 1w[fHL-T E1SLr L1DXuELVr 1ɺ1L Zu1LEL]r 1Y^DL= H ? L n H1E1H-,O Lb 1D HE Lm LL$LHLٔAą4LD$MfDAWIEAVMAUIATIUHSHH_@dH%(H$1D$HD$ HD$(HD$0HD$8H f$H$HT$HHt$@HLT$`E\$\EHD$D\$E11PLLLHD$@PHD$@PHD$@PLL$@MT$H LVM2 x[H3$,H3$$H  I LLL$(H%H-HHD$ LH)HHD$LL$(H HT$Ht$ HHLL$0HD$({L\$( H5A%r0N*>I3C H LVM2 x[I3SH  A{LL$0f HD$ I;C HC1HHD$H  L|$(IDd$LILl$0MH\$8LHl$@fEHL9 LL ooo o0o@)$ oPo`)$0opo)$@o)$Po)$`o)$po)$o)$o)$o)$)$)$)$)$)$)$qHL|$(Ll$0H1H\$0Hl$Hp1H\$@t$ Lrb Ld$0H5YB MHD$(H|$8Ld$xH$D$`AYAZLHAoN 1ɺ 1H5; AELHLHLyH5TL^ V kL4] 1 H5; 2 LE] 3AoN@MLl$@IGI?Hth  LH$fDHt H{bFLUM WD$P;HHEHH9LHL ] 1 H59 xL\$L7Y 1ɺYH59 1ML\$L@HD$hHD$pDD$PEf/t^HL$(Ht$HAa9L> ^Lt$`Ld$XX^HtHEHtvH9tqHpH=2> 1E1訹H9t9H@HIL\ P[ H58 1>AXAYHSH5SL+IGH I?LL$LZ 1H5*8 BL$LZ 1H57 Lx[ 1H5hQsxL #1ɺB1H57 ML"1ɺ&H57 )LL$L Rwh HL$0h L\$L%W 1ɺ^IL|$(Dd$LLl$0H\$8Hl$@L\$LV 1ɺyMLD"1ɺI1H56 TAhA~t}AWIAVAUATUSHHYHUILH1HILkE1H)L%7v ILJHDIcLHH1H AI9uoEoMHoU o]0oe@omPAou`o}pAOooAW A_0ooAg@oAoPoAw`oApoAAAAAAAAHL[]A\A]A^A_L }H 1ɺl1L~H H55 ĐAWAVAUATAHUDSLHL6LnNDVK.L$L9#*HCDT$ EPH/H 1APL=4 1LHY RLj#H 11AVALOY Lj_AXAUj11ALNY LAYAZ1ɋD$A!LLHY P1jA[XDT$ EAD\$ oAR1L1jA$L0Y kMY^D\$ vfH!G EAMt AEuCHI9FH|$PtHD$PL0H|$XtHD$XL(H|$`t HD$`\$H[]A\A]A^A_PHF 1APLW 1H52 RjH 11AVAjLW H52 lY^AUj11ALW H52 B_AXAD$1ɺ!H5x2 LW P1jAYAZH5\2 DT$ AARALW 1j$1A[[HAL*X 1AT7H52 1I]A\L=1 D\$ HL1jALW 1ɺ+fA_XD\$ .fAR&1AjL;W 1ɿ/XZAR11ɺ&ATAL W LMXZD\$ [USHHdH%(HD$1H軡tH$8tkHhH,$8%t!1HT$dH+%(H[]@H5BHAtH5\ H.u"C$H9Cc@H5CHqH5HZH5CHMH5 H6H5C HH5C HH5C HoH5U HXH5 HAH5BH*H5) HAEI/1H- L C H1L1ɺH1E@ALU 1!H5B QG=.AWAVAUAATUSHH(dH%(HD$1nL#C$HHH[ HDA$<+<-IC E4$LT SAFըIIIDBuA.t D:uzuL|$LLIHT$:.~E>I9EH*@fA*Yf/i A, < f/CH,C HCHCAD1 }.xH5D$_Ht)ALLXH5;D$1HT$D$E>I9(f.EHX;HD PH5 1QLS E1lpY^C@IEf.L9S XH5 1E1)HD$dH+%(H(D[]A\A]A^A_DA>HT${H :?@D$D$1H=>h H49t6HsL? 1}H5 |Ntr @At YsXfD\H,HCH{?L(? 1H5  h: f/s"L,L%u'Ys# WfDf(\L,I?I)HILQ PH5 1yXZIH 9AWAVIAUIATUSHHDbEHHxHhHu.HS`Ht D#E AHD[]A\A]A^A_ÐL{`Mt7 {MtHk`LHqHt HxHH@HH)xMtIF@H}f+oLQ ?fHeb1jAfA'H5= Vt_AXHHxHhHDcL{`EMtoMLLpHHxH  tuGe uojOLvWIH5 1fDD#EsLP 1KH5XP;Gd 1NL\IH51fHLH(L\O R!1H5HXZ@H{LO 6H51E1L,1ɺ1H5ogf.L+AąrL1ɺ,1H5,$H{ SHAI1H5_/E1L}N Y^@HC`HCPHMAL6O Rff.ATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$HD$E1L%Q D$0Hl$ $Ht$1E1f/AHHcHS@HtH@HHfz(tƒz u@tHt$Et $HH~ATLH1LQH5UXAZYHHHckHD$dH+%(uHD[]A\t@AVAUATIUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ll$ H$$HD$E1H-,P D$0Ll$$H|$E1E1D/AL0ID$@HtHcHIHf|(tEtH|$Et$1L-ruHHN}ULKALH58XZOf.HAH0bHD$dH+%(uHD[]A\A]A^AWAVLAUIATUSHHHHT$QDLD$dH%(HD$81HG@LLǁH/f*$ *E1HL%};LL?HHI H@H ;@jAA1hLhH5 H51pD\$ fDIE@Htf'fX'D\$ L> IU@HfD\$LH(LA H5O1ؾD\$tfD1LH5@ D\$_D\$HHPcD\$L1ɺH51bD\$L%L1ɺCL.yff,t&E1f(!L%Jf.LitCMe@C My1L1H5B= \L)1ɺ)L1ɺ@L%1LJDD\$H1'jALAcH57& .\AYAZD\$c HH@DHA L1jAhH5% hhhhj!jhhhhhjMhhhhhhhj\jUhhjRjKj8j4hj&j%hhh\H 1LAúIE@Hf'fyD\$L9 KfDD\$L8 *DL% L=1ɺ=L膹3XUH)JJHD$1LH0'/HHD$0I3H L= EfX'fDD\$1ALjAfebhH59 j*j'hhhhYH@D\$ IE@H~C@Dc$EL%L9 1_LTH5CLE+HHW H@@H{HLC`1HtLKPMMMLKPMLLLL$9LL$L%L'< L臷D$HLFLH(rHHfMH'H|$HGHKtHSpLD\$LL1BD\$CHt>HCIU@H0f8)") {D;IU@HC1fKtHHVf8,,C| H@ HHs Et {p0 uHD$H8oIE@Hf8##PCxw PD\$L:DL%|D\$IL.4 HD$HH@H΅AL9 <'H|$T'HGxD$qL4 HD$1LH0P!/HHD$0HD$iLL$HLKXHSXLL(](HS`LcXHvHLHT$蟽HT$J HCXHD$H{HsLC`MHIE@Htf.PL76 HD$HSXLLHHCXr\| H{Hy HHD$LC`HQcHHsxLD\$HLLAHD\$HAtfX'D\$1ALjA!hH52 hhhhRH0D\$ID\$LI1ɺ%D\$L11ɺy ML>6 L%ҹ1LXHD$1LH0/HHD$0HD$*HHT$0LLZLc`LD$0MtLLLD$kLD$ H{HLC` HHD$HQD\$[L1 D\$L21ɺL)HH  H{HgL63 }xHH SpD9D1APLN6 q(AL%Z1LXZ)LH~L%*L[1ɺ]L褯1 LL$LH.LC`LHL%L1ɺL8HHEAxAL.(HpHHCHHQD\$L1ɺUdL1 D;cpEVL4 q(HA(APAQLu2 IL%1LlXZCxLD\$*L 1ɺIH51&D\$1ҾLD\$MRD\$t[ǃIE@Htuft tVD\$LV6 6Lc`CǃIE@Htf I]HMeHI9tKD\$LAfft'LMH}LL角HL9uDHD$H|$Ah HxL%lL1ɺL1CC|LD\$D\$C| H@IU@HOLD\$PD\$CL ti L EQ1L 1ɺH5D\$)HD\$IL%|L1ɺbLAL1ɺ~1ɺaLLkëE1aLD\$L1 1ɺIH51芫D\$HǃIE@Hf.Sp cpHHt {toIU@Hf8)tt 0 C|1ҾiLD\$OD\$ǃMe@MfA$t1ҾjLND\$fA$8t3I$HD\$+D\$ Me@M{fA$(kHLD\$JD\$JL%pL1ɺlLL1ɺ1LͩMWLU, Rf-r=:L/ D\$H511qHD\$HA(L%L1ɺzL:L%L1ɺL^L%rL1ɺL7DH1ҾOLD\$EMED\$C;L V1L%L/ L耨L11LcɲL%L1ɺL7HHLH(1L 1ɺ3H5ZD\$CpD\$HL HHeH{HHLI(L+ D\$L'ML0 H5GE1D\$LV) D\$EWL- q(L HHH{HaL* HLH(ATAPL* 'LZ- HCHL%L* LjL%ɮL1ɺLCL+ [ =Hǃst9s|-AI}D\$A$APjME As|A$I}$IEMw HAZL- A[=6H5LJ(AT[P11]CtC|A\XD\$pf 艃f ꉓ9=i6L(VD\$H5R11ɃۤD\$1LI(L* 8LH(Lk, AL%1L}LH(a1L 1ɺH5D\$ACpD\$HLH(L+ (u|ALTA1D\$H5ԣD\$E1xLC`L%"LS1ɺL蜣L%Li* Lt1LH(uR1L 1ɺ;H5D\$)CpD\$HL* /jL>* 7Vf8)L% )f&t3|&ƙ1LE1yIL t;1dǃ1fIǃELH(L]* IL%L1ɺhL/f.&oLG) _fAWLAVAUIHATIUHSH8HL$DD$LL$dH%(HD$(1L9HDFa0A|$hD$D$ HEPUpEt$`HEQDH9DH9HI}Ej)A$MHAA=N2A[IL¯X1ɺH51輠HHHU`ƀL$ 9L$DEHHT$HHT$@DD$HL$HLLeHtHLHT$H+T$EA$AL$pjH!\LPED$tt$0H AÅHtHM`@AD$\f1Hu.ASfDkHD$ D$fDEL1ɺNH5NV16E1HD$(dH+%(0H8D[]A\A]A^A_DH9HRH>HQL' IH5U1躞E1D|$D|$ D+|$A$[E\$E5Mt$@H]PHT$$D\$LH7>D\$*T$$HAVL dH5h L6) LD1Y^D\$D\$L1ɺ@H5T1՝D\$HpL& 1ɺEIH5T1蜝A^T$D$E$ED$tAL$p DT$EHHLD$PAQEt$0(H IE@HU`Ht f"u AD$\@\$9\$ZQDD$HL$HLL 1D$Li1ɺf.HI90HI9uLD$T$DHLu<1A|$hXHL7& IbLD$E1DHH d^ AÅBHU`f.LI% tH5R1̛E1@HhLW% ILO 1IH5 tL1ɺgD$L1ɺafL& Kf.HD\$#D\$taHL$DLHD\$L1ɺH5 ˚D\$D\$LX1ɺHQL% IH5 1zD\$qL 1H5 LD$L1ɺHHD\$I9~HHL`LrD\$tzHD\$oD\$t!LD\$9yLH^pD\$tCLD\$8D\$t-H}PD\$1{D\$tH}P/kD\$LD\$H-PL# HI1KH1L# +D\$D$L^# 1H5PD\$ZL1ɺAWAVIAUATUSHHH$L$LLD$@H BL$H$dH%(H$HAHL$xH AHL$pH AAHL$hH$H$HAHT$`HAHT$XHW R$HL$0H$H$H$HL$H$H$H$HL$H$H$H$ HL$(H$(H$ H$0HL$8H$8H$0D$HL=HDH$HYHD$%DH$@HL8/I /HHH D$@EG LI~L`LIHtLLH٤II~Ht$L%|-L赛HD HHD$ 蟛HT$ I~HtHt$ gHt$ HMHD$ HI1LL-I~HT$ Ht${HH9$qDŽ$@H+}@} LeL LI~LhLIHtLLḤII~Ht$0L{rHt$L 耕D$HHt$1L 1ɺ.YHD$@HD$PH|$@ H$H>HD$hH>HD$xH>HD$`H>HD$pH>HD$XH>H$dH+%(VD$HHĨ[]A\A]A^A_LQ )HDŽ$@L+L觙I~L`LwHH(LLH}}@/HVHHH$@HL L1ɺFHHIF@L-& IܺM} HtaHRHHfx(tOH(HtG/HڜHt5H1L HHoMHL(IM9tIF@IcUHuIM9uML耘I~LhLPIHtLLHZII~Ht$LxgL L%H$@HI~HlHIHPHL$@1LHIHI)I~Ht$L xH HL$HD$@HD$PH] HD$PDPEt Hx HD$0H9$u1HD$H9$n $uHD$PXt$H5²L|`L,* Ht$1ɺc1L Ht$(11L% L|$L9$ HT$(LLyEOЉ$L9$u  Ht$(H|$8SBH:HDŽ$DŽ$H$H:DŽ$H$H:DŽ$H$H:H$H:H$Hl:f:H$H$0H;D$8HD$ L4$Ll$!"!D$HT DŽ$HD$ DŽ$L`H@LHHD$-HtH|qD$HH|$Ƅ$PHZH$P@H  HD$H$L%9L|$0H9H$@HD$(H$HH$@HL9u@LLHHI/uLH)I9dHL9Hk/H菘IHuLHuHD$(H$HH$@H$PH|$H HDHMPHt$ L 1ɺ1#_AXDL$HEtH<$1H$L7HLH$PDt$\H\$D$HT$DL$HLEHHXZH$PH$PLD$(H$$eY^XH$MtgA<$#t`H<$I%tW uDEH$HtP,tHx@P,%DH<$LOH$z$ $~DT$HEHHnHt$11Lc! |MtVA<$#tOH<$D X$Ete uDEP E,tH}@E,AH<$Lp HD$HH}/tLLIH|$HHt$L[11襌D$HjL?oHHD$H1lD$HHhI~H8IHtHLHBII~Ht$LqHt$Lw D$HqfHt$I1L^軋fDLHHLIHL Ht$1L iD$H.H$@2ILLHhH$HHxIHtHLH"IH$Ht$(LHxjpFHt$L] L4$ΊH= }DŽ$H$$H 4H$H4H$H3H$H3H$H3H$H3$9MH|$@D$HHt$PL8Ht$11LH=T H$DŽ$MtXA<$#tQH<$$D= Et D5EH$Ht P,?H<$LˮH$DŽ$HD$HH2H2HD$ HHD$ H;D$8FL4$KDL|$0fDH$L|$0H$@L%L2HD$(H$HH$@HhH-2L9ML 12H5lH<$H$H-OLE Ht$L1ɺ $HE1L$LL$`HT$8H|$݈^_H=8 Ãt&Ht$11Lk辇H= p$9M؉$MtXA<$#tQH<$ zt u+HtE,tH}@E,aH<$L菬Ht$L1ɺ Ht$L1ɺHt$Lz1ɺƆH= pDŽ$DŽ$HD$(H9$ L$LHL$8HT$(LHt$;=Ht$L1ɺZ9D$H1L2HD$PHHt$L1ɺ3D$Hf.1Ht$Lp1ɺg輅D$H`|$H'SdHL2Ht$L 1ɺ9YD$HHt$L11L4$)VI|Ht$L1D$HuLIHaL$@bL }LmLL袉I~L`LrIHtLLH|II~Ht$0LiH [HL$L 9H51"D$HHD$0H9$mHt$L11qD$HHt$Lm1ɺ蹃QHt$LK1ɺQ藃D$H;E#Ht$L `D$HL.Hx@P,N|Ht$L1ɺ ‰gMI4LsHHD$H1ĂD$H?HHD$ Ht$Lc 11w臂D$H+Ht$L ZD$HL1ɺRHBHD$H1$D$HL sH5D$Hp裈UHHyATVL LDHLa HHD$ 1蚁[]D$HfDAVAUATIUHSHFPH@HpHG@HtbfvXLA1H58$L1ɺ-1H5sE1[D]A\A]A^@HHU|L}tu`HE`d$HE1HE`c1L* 6IH51菀1HX[]A\ADA]A^HH_LHVAŅHM`HL5DM|1ɺNPLL P1X1ZHWAŅtCH1ɺVLIL 1HL)AŅA[]DA\A]A^@ID$@Hf$fH1L I1E1H5.[D]A\A]A^fHL JIH5c1~[D]A\A]A^Df/ffHxH=q H1UH tD)DHHL$LLD)B0!yDsA9~Lcd$f.@D<-1HD$x"(AwIH C{HL$LlHD$@LH8 IH HMOHǺt$LL1HaMgA[[LLcd$:|$ MHcL$ L=z:DŽ$HHL$xHiIHL$ fAGD$tfA_I/fAAIcD$(AL$HD$D$OdDJ,A<$-D$t$LF4^A<$OA|$OA|$_H9H\$ LfK fD$ZV6HH e~HD$HHx HD$HL$ H$ H$HxIUSHHdH%(H$1HHHHD$HD$HD$HHHD$PHD$4D$pH$HDŽ$DŽ$t )ȍTHcL%0L HL HD1H‰$HP11RIѺIeH$H;H$H$Y^H5^H$HtAHHNHtYHpH$dH+%(urH[]A\fD1ɺLLզ-e1fHL Lc LdX1Z{SoAUATUSHHD%sdH%(HD$81D$EbD% E"LHHLhHH|$jAULc1L RH֙H ATH5 R1UHl$XH0|$HL$HT$ HAD$ tYAxOLl$ Ht H}sLhHD$8dH+%(HHD[]A\A]fP1L  E1L H5f.cXZuL 1iH58.TcdL eH5.&c61E1LLH5-bXmATIHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HH$D$ HD$(HD$@HT$ HD$,0H5z HD$8$$$foD$ foL$0H A$AL$HD$8dH+%(u HLA\Jlf.AVfAUATIUHSH˹H@dH%(H$81H$xH,$)D$@HD$PH\$LD$LL$ I)D$0LEH|$`HHD$`HD$HH$pHD$HHT$(Ht/HHt#L5fHL|dtPMI}IMH1%WH$8dH+%(H@[]A\A]A^fDHH$HtHC`LHHJcuH1 yHH$HC`H^fDHt6H HD$(H HC`Ht H@ HD$@HC@Ht2HD$HHD$0HD$(fDH1ɺL6V o oS$$@jHIE11L$LGIwNI:LAI9tt<_uIAAI9uHHtD@H1L H52$1HE1AVAUIATUSHH>uW/EL5@u(I]H[]A\A]A^D@ tkH@t1DHL Ctʄu>1L( B H582r[1]A\A]A^tHH8uHIM[]A\A]A^ff.Hu'u[HHGHIHG HHIH8HDH5IHIHD*HH8HWHG H9uHG@( tLC1ɺ 1H5F1vff.ATSHHmHHƋ@vA v>y1E1L H5HD[A\fDvH;11wAątAHD[A\Lt1ɺ~1H5@1E1LG1ɺcH5HD[A\AWAVAUATUSHH $HH $Ht$Ll$0IHHT$1ҾL$dH%(H$"HGPLH(1HHLh,5ML$HLLHD$0ID$PH%D$(L1EMHT$(LHȢAąD%EeIHH$\D$_DL$Hh"AH$H HD$H1蹴D$(IH5]HL$L$PLHcHt0PH5;HcHL0PD$(HcHHt0HS Lt01L5*'SjLL$ L$L\$:Y^1LL$L1L8 ZH|$LybQLYidHG 8^a$HIHHDH APLSPLL$8L1ZH Lhetec8`1LPH`L<PLL$(1YXZ*fL\1ɺ1H5&YH$"dH+%("H"D[]A\A]A^A_ID$PAt$HML E1H5%16Y_AX뒐bH 8`$HIHHDH APLTSPLL$8DL 1ɺ1H5%AX @HT$,LHAąxL$1ɺ1LkXVb1L H5$?Xf.AUATUHHH dH%(HD$1ILl$L,$t~H}PAątFLHfeAątAHD$dH+%(H D]A\A]L<1ɺ]1H5ӛWDAL11YH5TWfL1ɺb1H5/WaaDAWIAVAUATE1USHHHL0H9HPHhEl$IVHL2LE`D1HHILE`KAątILM9tqIE뫐HH-ALs HI1nVL 11HQVHD[]A\A]A^A_AAWHAVAUATUSH(LI9trAHHAA͉D$ IGH@@]jC@`uH|AąEIGH )HHPH IHLDHDI%AV L5ATIL LW1GUH}PY^HWLIVL0l$ HPIVHIF"f.EIHxHI$J|(AWLG 1SHt$0I1D)K^_H5I|$HHI$J|(\I|$H5*qHHI$J|(#nI$H [H4BoJD*HD2I$Bo  JL(HL0AL$L?DM;$$tHD$8H@PHD$XHI98H}HL$(HHH|dH1ɺ UHt$0IL 1JA_X DHt$ A1L [JL4 1 Ht$ 19JD$@HHL$(I,$L|I9ufHmI9HuLtbfDHt$ Lo11IYH1HI9uH5KH~HE1fDH H9uVL 1RDL$ Ht$0LI_AXD$HD$xdH+%(tD$HĈ[]A\A]A^A_HZL1ɺ HD$ Hƿ1HHt$ L11 H댋T$ D$xL = YH|$8D$ELHKDmIHx)HL UHt$0I* 1OH[]Ht$ L߉1ɺ +HD$D$ 7H51Ht$ Ll1GHt$ LE1G[L HHD$ H1GHHL$ M,$HlM9ufDMmM9IuHWtl$(L xHt$ L1ɺ GD$HM,$HhM9uzf.MmM9IuHtL\ HEH|$8H8HL` SH\$0I 1H[FXL Z H19FD$HM,$HhM9uMmM9IuHt;H W$H5.H=?HH|$8uH|>z$P@AWAVIAUIATIUSH8D$,H@HHHt$HDD$(H@HT$H@PHxIHHHD$1L=H HHD$ EfHHL$H9HH9tYL1L  L$ D1Ll1ɺLD1H8[]A\A]A^A_@I$HLhH@IT$HB H!HHLHD$LH1Lt$I1L +DHD$0I!E`LZYLL1H5 LHH%L=D$(I>LkL3IFHHCHI^HH;l$vT$,A;T$LHH9T$%IDŽ$H8[]A\A]A^A_fHB(HD$fI$HLhH@fD1ɺLLB&LF1ɺLLmBL\1ɺ1LBfD1ɺLL%}B1L 1ɺH5OB1IDŽ$H $H5wH=DAWAVAUATUHSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1HD$ E1H\$HHT$0D$0IH$ HT$ LjHD$D$ Ht6HB(Lr D$0Ht!H$ HAą51HAąH}P1LEAąHL-'舽L LIo1@Ht$ HhAąHtLHAąH-Lv LIz1Z@A1HAąA$Ĺ1ɺd1H5c@HD$(dH+%(XHD[]A\A]A^A_fDHEPLH8AAąHnLZIH51?DD$ 4DL1ɺ}1L[?GfDL 1OH5,?L1ɺ`1H5S>f.L1ɺq1L>fDuL1L3 >Iff.AWHAVAUATL%ULSHLH$I9ŸLd$LDE1HEIUMI DH H#BtAFLM9v9v~HEHuLEMLd$IEAHH-ˡLHDIEHp(HIEHP HHHLIM1L9<$LD1 @t`AILH#EtIGLH#puIEPHHHH9uCH@H9t7LH#PtA@ufHEHIVf.L1/H5$t@HSI<$HRHPIT$L HPIT$HHID$H9t8I}HuLE1OH5N:HL[]A\A]L 1FH59H 5$H5 H=]uHIHIL;Q@t'HL9tPH1uHIHIL;Q@uLHAHHH9UHH@H@L9P@t͐HH9RE1LDH% ff.ATUHHLgPI$Ht u(I<$H蜷Aąt5AHD]A\@I<$HH]A\1Ly1ɺH5m8HD]A\@AWAVAUATUHSHH(LoL~MMMWLLMg(LT$Mu(LL$Ld$fLLHHULL$M;MLT$AuM;u(t1HHt@H5|LT$:LT$u!AH(D[]A\A]A^A_fM;WuHD$I;G(DEfDAWAVAUATUHSHH({ADA9"DED$HCHUH@H9BHHHL$HD$H9HLHD$HD$H@LxHHD$I9IfDM6M9IFLHpH@uME1L GH5h 6_AXH(D[]A\A]A^A_A9*L H515AYAZDHD$HHD$H;D$LLM9F5M}&IG@HHx8/I@H[2IEHH@@HHHyH9pLIHL RSHL P"H514H f1E1LL H5b4TLE1L9|$HCHUH@H9BfHLL :1H5V3XZ@LHLHD$M9pE1f.IM?AM9uLL9|$t'E1IײM?AL9|$uED9l$2DL MmM9LHL9uMmI9 MutIF@HtHx8tI~@H/tIEHHP@HtCHHt;H9t6LHHL \QxL ?AfL (fDAWAVAUATIUSHHHLoHH>7LLpLHLHH@M$I$I$HD$L9BL=,fDLHH?HEpIFH@@HHHH9LJHV1 SLd Lo1IFH@H XZM6L;t$InHupHt H;tH96LL`L HAIFHEpH@@Ht HHtH9ugL L P1H50H1[]A\A]A^A_L i@H[]A\A]A^A_@LJfIٹFIDŽ$L bff.AWAVAUIATUSHhHn`H<$HT$@dH%(HD$X1HNtu2VhFpt<'H$L@d4 H@PHD$(0H<$裛AąAEptH$LH@PHD$(HD$(MeHHHD$8H$HXp1L9\$ HDL}MM9I\$(LLH9LtH5H9LMg(AGu&LL9tH5ذL9E}TE H<$L= 茫S=<LATI4Lp 11.A[[H$D$TE11HI9t^GLt?HH @HBH fH:u HRArHH9uH?L9uEtt$TH<$1HL$THjyD$TD$4AElDd$ 1ADžAEhAD9H$HL90Ll$HE1LE1EIHCDcLDkPD{$LXELHEHAT$HRH|HH98uHPHHH9HQHRH%`tDaLI81@!EE9 EEHL93Ll$HM1EUhIMXEeTA}PED9T$  AmTEUhD9T$ A}AEH<$DT$AH1ɺnID$<Lt H5gPD$PDT$(1AR),H HD$XdH+%(#HhD[]A\A]A^A_HELxAEUPE-L OL=1L+LUm1ɺD1LE1+o@A&1E1ApK8HDT$0LL$ DD$t$L$R DT$0t$1LL$ DD$AċL$@4L[ACa L߉L$0DT$ LL$DD$t$t$L$0DT$ LL$DD$fEE9 EEfHHRHHH9>H5HQHRhH% fDHQADd$ AElDEd$4RAEhEA)A9WH<$ɦLX IH_PH1ҋHIHtv~ltHHHH)L=HDL$Hxj|=^x_ILL 11p)H;DHAEh1ɺ}E1H-jLjH1)Lj11.H)L=2Lj1ɺL(M}H3AETH<$蹅AEPxMA I11I9u(ft 9t EMTEtYωHI9HPHRutt tՋH8MEHPLA+P9AAEttI}XuLw nAAD$Iٹ0L L=1L'H<$蜓AąL]i1ɺ:1H5ԕ'vEEEAmT DT$MeX-DT$ I9DHD$(I9v L1H1Aԅ\$ D9E}pED)H\$(D)9DпED)L DHH51P1&EUhE)EUh_AXH $A]HL9.CHG@sHAPAuhHD$(AuhZA}H$AEHL9w H@@AEH$HH`H$@a?A]PT=aAٺLL=11L L%HEA]P@ EL1]8I]XAETv I}XA}lA]htD)H$Hx`EEtSHUHB"uGMLR)օY98މ1҉1؋D$ 9\D$ H4$DHHV`EUhHt H$"H'"H<$HHH4$HVXHFPHH|$8KBH|$(AUh틏HHHсHH9t$ 9rAuhHH|$8H;tKHCL=SLB LHH`=sADž11#EUhD+\$ *AL=L1L #Ll$HDMD)EUhAETAuTI}XHD$8HL=yDL$@t$HxHj=y_LIAXL 11"I]XGLDELl$HID)˅t1FEUhH<$L=ԐUjLSIL 1"A\A]H^Hfn4fo Ht$(fr f8?frf~9D1A9HD$8HDL$@t$ADHxHjAAD貈IHD$HDL$@t$ Ht$8Hx$HD_L<$=ײL=I1L 1LJ!XZ9[A qHLPItAU=f]HL 1ɋD$PALsb1ɺ41H5 mH<$GUL IL BDED)L >HH5e1P11 AmhAE)EUhAYA[L<$AuhIPH|$(z1Ƀ]IGPHD$(]H$LM9\HA1L$HIEh>L$L)$IH)$)$)$)$L$`H$)$)$)$$ILHƄ$DIHDŽ$H$HIDŽ$(DŽ$4DŽ$pH$HDŽ$DŽ$Mt/1LH LUoHD$ IHD$0DDH$HL$PH-ԵDHH DɐLt$ 1HH AHH$HD$DL$L$XHxj|M1ɺH$H1LQ H$I>H5H$H$AXAYH$H0H|$ L.IHHHH9t1fHH9u,HD$(H|$LD$dL4葓j1LE1jE11^_ LH|$HnH9\$:HH@H-B1ɺ1LUH H1L DD$dEt`H\$(L$L5 f.HI9t7H;Ht uMHHhI9uH|$ tH|$ 1HLz  1'@1LT1ɺH5<1H$dH+%(mH[]A\A]A^A_@LA H5111ɺHL-TL!T1ɺf1HhyL 1H5<f.H1L H-BL 1{H]L$hLd$uIHt$HLLt u[~uLD$D[D$|L D$<Å AHD$0Dx Et$<Il$H5wAHHD$0H-E@ Dl$hE7L$lO Hl$L|$01H9\$l3HL$H[HHLhHD$(L4MtH5L蕃HHHt$MMH1ɺ1L f1LLH "HIIIM`H9,HhLIN`HD$HD$IUhLHǀ AoAoWAo_ Aog0uƀJu ǀDEu ǀHH HL AtAi|$<AEg1H-8Lη HDt$hEzLwP1ɺ1HLaLŶ ~IH5Ѯ1H-L_ 1,H^oIl$H5tHLD$`E11D$@HH5H-RHT$HL$I$hLHBPLJHH#L1Pg11Ht$|LL(D$|HL$0DI El|$hA =AP=ŞHPHD$@L 1DH 16 AYAZ*DIl$H5~sHD$@D$`H- EHD$0@ D$dLL bH-1H DT$hHl$EH\$H1H1Lķ LKH^ 1HWHD$H1ɺHLV LHH1& HD$L$lHH IHPHt HHHH9(ǁ HH9uH|$ `H|$ ^LTL` rIH5ī1} L @L_IH-1HF WLLd$wH5^IL 1 LeLHL蚇L yIH5 1 H|$HLH9zT$lHD$H1ɿHL LHH1o H|$ 9H|$ 'H\$H1H1L LKH% HL:$HD$H1ɺHL LHH1 DL$lEfH|$HvLEIQHl$LDK1ɺH Hl$LK11Hf wH|$HLHi1ɺHLJ) ILJ1ɺ1H LJ1ɺ1HH1L `D$h D$`D$@D$dD$DD$<Dl$@HL$0EDI EEA92APL H-gRH1 Y^Dt$DE EuHD$0A@ =@EwH-11Lް HHD$0D$|@ D$d4L$d© ‰Il$H5mHD$dE1D$`D$@H|$H̓LHI1 H1L H|$HvL?HI1l$`EtsAtp|$@%(HD$0A@ P=H-yRL 1ɺH1"A[[A|$@%AHL$0ҁDI 딄LDAEgHD$0A@ HH\$H1H1Lڰ LKHt1HmHD$H1ɺHLl LHH1<]D|$dD$dFA9=}AWHPL 11XZHLǰ HL$0=w8A H-GL H11ɃD$|A H- LE WP]LASPHJPSH1\H L91ɺ1H;A<$H\&AVIكPH LzPS1HH DO닋8AWMPHL0zPHHPGA<$SHY\PHsIٺPLSx|$Rtj|$H;HHA<$?L H[HbIHA9VHDAPLzSPdA<$L R APLMPHPHbP-A<$L 4 LWPH PH,PfDAWAVAUATUSH8T$LD$DL$(MHHL$HQ HD$p8HHHHHD$ HL$H9&D$D$,fDHD$\$UpHAH|$\$HGu0wAݸA)9DFDl$fDDT$HE1HjjDjjjQD$HDPjD$pPL$H|$hHPIHHD$\$E1LpII I9II>ELKAvL$AUPA$RID$HuH-+c1ɺ1L6HL611 HLc61ɺ$1HE1LC611HH8D[]A\A]A^A_D$HHIEHHt$IEHL(HD$LpupsHD$HHD$H9D$ HD$HP(HEPHxHGH@H@HHtHAąaA3DHE1HjjjjjQjjD$pPL$H|$hHPIHH-aLR 1HQ@ ED$,D$xH-SaL41ɺHBHH9L H5a1E1?HQAąL 1H5`L Lӟ L41ɺ1H5z`FH $H57H=7fAU1ҹATUHSHHwHLoPdH%(H$1ILHH5LH1LL莑t LH5LsHZLI}HXHbTH W$ATfTfDD$HmL̘1ɺIH5ܐ1H$dH+%(HĘ[]A\A]fH$HxLHHILHLHH) H)։HHHauL)21ɺH5LnrfL11ɺ1H5"?Cf.LMH1ɺLa H5 $ۉATTOVfDAVAUATUSHdH%(HD$1H$HHHIIL%H)f.H<$zH[HtaH 1HLLJxrHsH<$LHuHUuL01ɺH5:aH<$1HT$dH+%(u^H[]A\A]A^fD1L01ɺH5`1L^01ɺH5`AWL=]AVL5YAUATIUHSH1HHT$ LD$(L̃ LL$0dH%(H$1VLLHYL^IDHLD$LHt$bH|$@j1SH%H Q$SLD$(HJ#L $$APLc1QHt$0H m%VH5? SLT$PHe%ARQH "ATSAUQH "AVH$1Hp|$@HT$z,uDUHt/tH5yH!4]1ɺH5fyu]AWAVAUIATUSHH5stHHdH%(H$1H5HAD#"AEuAL$1ҹHLEHD ՃEt=DΦ"E=˦"5"Et+"t"A"!AH$dH+%(HĘD[]A\A]A^A_fDIٹE1Ƅ$L H5w(fD" ""tD;L 1H5wE1>A@t  iu9HH44HUH޿L1DL-AŅtNDL 5u(k_AAE8SL11H5vсtqEDLX)ALC 1H5?v~fZ(D8LHL APH,m LPHpH5P1 HL 1H5u 11L H5{uEW8HL PHwLPHpH5P1`H fAWAVAUATIUSHHhH$H$Ht$L$HD$(H$LD$L$LL$ L$HD$H$dH%(HD$X1FAEH$AA?nu AaRrԑdLT$H@=YLXLDM}Ht$HoL\$(H|$0jL MLDHHDHHDHASHDH+ PH SPH RPH t$XPH Ht$XVLPHN LT$`ARPH? UPHj AWPHcH j PH$1;H$LLꋼ$HĐHqJAHM1LĆ PAEH5@P1t$(t$(AWTH0Hl$@Ht H{6H5HT$XdH+%(Hh[]A\A]A^A_DAtGHt$HH1?HH|$0jHDHL . HDHHDH( SPH% RPHHt$0VLPH UPHi AWPHcH {i PHT$x1H$LH`|$0LHmpH1MAWLƅ H5Hl$PXZHt H{5H1@H?>HH|$0jHDHLHDHGRL -PH UPHh AWPHcH h PHT$X1H$|$pH@LLHo,AHM1Lth PAEPAWH5$1>H DAML 1ɺPAEPt$AWyfAWAVAUATAUSHH8HL$dH%(HD$(1Htk>#HtcI@tHne{x{1E1L*H5C_HD$(dH+%(H8D[]A\A]A^A_fuHu]{nS{IHD$A{AAduAHeu CxH5hH4$u H OHEH$HD$y@/HHH$Hmu HHEH$f.=.tyAt}=-LHL$ =% m=&HH? HEu{n{A8HD$AD$ ;uu{nu { fIL^ 1L 1@@AHHH$H HHEH$C=IL5d L1 -HD$uu{nu {s{h{IL 1ɺ L1AEHD$ uts{h{IL 1ɺA 릃s2{h({HIL 1P/ L1AY^/{nw{hI Ld L1E1j="=!u3;s7{h-{#ILt 1ɺY = uu{nu {bs{h{HILUb 1P HI3 PL~ 1LE1XZ;su;{hu5{u/ILP 1ɺM IE L IQ LO ;suY{huS{uMIL 1ɺe I] Lw ~HI PLa 0Ii L G.f.@AUL-2I1ATL ; LUASHHdH%(H$1b@HKH11Jtb8t}(;ILIH.HcH HDHE1APLTvQP1H H$dH+%(ueHĨD[]A\A];u+ILL1E1HHxƋD$%=@tf.AWAVAUATUSHH $H|$t$ HT$dH%(H$1=*uZ{1E1L=H5 :H$dH+%(HD[]A\A]A^A_fDHY*1L$HH9 L"vLIHLd$ LHx.Hhu}t߀x.u}.u }tDIHHL1!AŃ1ɿ1ILH5 9LcH{f.E1LXH98M1PHL PH5s 1_AXT$ t$LPALLMcBƄ,mD$8%=@LYIHL|$LxHx.LxuAtD`A.uA.u AtDH5:7 L!tH5rLtH5(LtH5LpH5;XLYH5hLBH5L+AmH5WL H56 LkH5{6 LTH5@| L=H5 L&H5<6 LH5+6 L1MIHH6 L2T$ t$L8@M1ҹL|$LLd$LAHL A0DL|$Lg~L%68I1PH,LPH5 1AXZ"fDH|$1ҹHHsHD$E1ƀAdt(Am5Aq*A@A-L= AQ1IAWH515AZA[H-58M1ɺPH&LPH51]A]?JH58$MIH*(H\AWHDH ŽAPQLoE1PH5@1H RH(58!1IPHH5PLX1Y^AƄ$fAWAVAUIATMUHSLHxDyT$4$DdH%(HD$h1D$8A VH X HcH>DAE D$<L5hkD$(D$LA1AExHT$A1A}hEE@1Ep1@Ip1E@ƍp1E@ƍp1E@ƍp1A@ƍpDt1GIA"GAHT$EL5j EM8AH KAtDHH HHH$EL1H2 D$D$L $t 1LL D$<13UHD$HD$(H|$D$(3L s LL: 2H|$ۉAAu N%HcD$1ɺ dAAXAD|$Hl$H\$AeAMh AAu  A AtB1H$H DIcDD$H)I<1rDD$ ADD$HHt H9 L HD$(HA ARE)Ӻ9I,H51L DT$HASD\$HU萔HL$81jHbLjH|$8PAGTPRHD$XHDL$hHt$HL蚾H0H|$ H,H-,H<LHEH|$LLPI}kI/HL-I$HHHH9LJH' LUL s0HC(ID$P1yHC HS0H H-HH-H9}ID$HX[]A\A]A^A_H9^H-PM[L a@I$IL$HtHHt H9"L H1QL2 H5蹒AOdAZA[AGd|$ tN=#LW H511sI$H=85pXD$ HD$HHL >FL 2ATUHHH5 HdH%(HD$1HtI3GH LVM2 x[H3UH tTHHKHUHHIH9@LJHL L1Q1ɿjA $ AXAYDMALMHCI9A$DE1!AA$HD[]A\A]A^A_f.HHKHtHHt H9HQDML 1PL1ɋAZA $A[HHtH Ht H9/HXP11L RLyA$XYʀ-HHtHHt H9HsL1PLs 1'LMHC^A $@_I9Rf.LJHHKHt HHtH9uGL HL] 1LQ諊A$[E1]jf.LJf.HB/HQHBkL @foATIUHHrSHz(HBHjBtHB(fHH8uϦgXHHA$蔞LHH1tE M9KXt []A\M[HzM]gMA\@Ht HHtH9u6L 1L  H5;[1]A\@LHf.AUIATUHSHHH IHt_H@ H@H@H@Ht HCID$LcI} Ht+f@ID$ HhHL[]A\A]ID$ E1f.AWfAVIHAUATUHSHHH$Ld$0dH%(H$81)D$)D$ ft$蹑肌LARLyvfD?/HHuCL= D$ 9\$ HLLESMH1ZYHﺶ1茎H$8x1HT$ϏWH$8t8<}IH IGHH5HEHH ! APLc3QP1H 9\$ !@1H$8dH+%(HH[]A\A]A^A_D1Lz 8H5脆1+8tHL P+HX PH5<1L2AQ:H 1ҹH5: LPH<Ƅ$./f. aAUATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IL%zH- @$LLHH$D$0HHD$HD$ HD$StHT$dH+%(uH[]A\A]{ff.AWIAVL5 AUATAUSH(H|$dH%(HD$1HD$tL5$ H LDHD$IL-Hl$IFHIt:HI!E9fu.MFMt%H HHIDH|$17ts1IIHuAMu*HD$dH+%(uyH(D[]A\A]A^A_L 1ɺH5|DT$܃DT$DD$Lh11H5K諃DT$w ff.AWAVAUATUSH8HH|$dH%(HD$(1HD$H9IHE1H}OHmMdLd$I9uI|$H|$蝆H$HD$ HhH$Ld$H Lt$ L=PH-DLCHI9txLCH1LLLuH<$H-r襇LA11H舂L$1ɺ1HE1hBH$H $H|$Hf1H5y JAŅt;H<$A$HD$(dH+%(H8D[]A\A]A^A_fDH<$L11H5΁@HD$5H$HD$ H=H-dL 1H|fAVAUATIUSHdH%(H$1H(HHI fD/H{/HHt_}tLH;xD$%=@tH/AƅuLt1ɺ1H5跀!DA<$uILAƅtaAH茅H$dH+%(ucHĠD[]A\A]A^fDHL蕅xD$A%=@tL1ɺ1H5聊ML 1H5E1X@AUIATIUHHSHHކHt]LH辄HtH tCLL9s7fDHAT t0 t+L9@ƃ@H@tH1[]A\A]H[]A\A]AWAVAUATUSL$HH $L9uHfdH%(H$B1HH$H)$LMHAվL$HHHEPLHL1Hh{Ht$L较L$!@ 1LLLADž8 Hcrypto_LH9$!AH|$8H|$EkLHߺ@ HLHHE-H51 H=J~L5bIHeLIHIHuI?/uI8/uH$0讂xHD$H9$0uHAw1IL1L 3}8 IwH{芈Y^cHLWLIH51E1|H$BdH+%(HBD[]A\A]A^A_fAH$LHH$91@ L}HL%= LH1ɺPLL$1L_ 2|A[X1H<$12rH$ljD$ǃD\$ZD1rD\$H$A}D\$Dy}1H<$LEUL@ H證9 H4$E1HH$fH)$0HD$AH( AHH 1%1)$@ jA1j jPPH IHH@HHxLPHML$H5@ YL$111At=< =tADNB0D΍BHAuLC$0mH$011 eHL IH5Ġ1z6@E1$!UKSML{LEz8 Ѓ ˆ8 KH8荀$LIH+HHDHAPL%SPLL$ 1CyD\$(H DzLՂ81ɺLPH LbPLL$1xAYAZ f.HL IH5\1x@L $L L1x?fDHE1HLPLL$1L #x_AX=L@AL11H5ϺwL1L wf.L $L L1wD\$Xf;8~1LPHO LȹPLL$1YwXZL1ɺ1LE12wOL1ɺy1H5wL1ɺ1H5vƄ$0J5DATUHSHHdH%(HD$1HH$~tfH$Ht HHtH9utL -HHJ1ɿPL%1L RLVU;vHT$ H HH uHu41HT$dH+%(upH[]A\fLHf.Ht HHtH9u6L R1\L U1L濄uXZLH ff.fAWAVAUATUSHdH%(H$1?/tS=H$dH+%(TL~ 1ɺH5 H1[]A\A]A^A_uIH5( IށIH1HDLHXyHtc$<#tImE1ME11`bjHCKHtVHHtNH9tIHBHUt$4H9tAHtH$H 1Ҿ H7Ht#Hx 1Ҿ=HcHH 0LlIHH{Ml$LcLM I$HADkID$H*=H5ɺID$(1AD$ va0N$lIHHL McAD$ I$HBID$H H5wID$(1a1Ҿ'HN$Dc.Mc0kIH H0+AF IHIFH~IF(kHH V(H 1҈-D I^pH5ZAL A 1D AA\$AA `1Ҿ)HN4-RLc0kIHH'DkAD$ I$HL DID$Hv H5ID$(1_0N$LjIHH3-M|$XMcI$HfH5[ID$HyLK ID$(1AD$ _1Ҿ+HN$Dc,1Ҿ-Ht,A\$HcHH8bIH HCILLILILHH0IDiIHxH+MuL IEHbH5IEHIEH IE(1AE ^1Ҿ3H+u1Ҿ4Hx+HhIHmL0HXLhMtIVAvLLb(`H[0@H@H@ I$ehHHHbLcL HHH5HCHHCHzHC(1C \HHT$XdH+%(pHh[]A\A]A^A_fL H5A~\1f.1>f0LL`gIHHMuMcIEHa L\ IEHH5IE(1AE [N,Dc0fHHHtEl$McC H~H! HCHyL HC(H5'1HCP[JEx@=LHL4;DHFPHcE1L H5LqH1?RXDZ[]A\A]A^Ð1Lʓ1ɺH5R[D]A\A]A^L1ɺ}1H5Q#f.LkhA @LT1ɺ1H5ZQfSfH1HH@dH%(HD$81H)D$H|$1)$)D$ Ht5H@ Ht,8tC1IL/ 1ɺ-H571HT$8dH+%(uH@[fDH@1Ҁ8HDT[@SAIA AHHAAHA 1RHjAXZEx [f.I1LL 1ɺH5r\P1[ATUHSHdH%(H$1IL^U.D$%=@tV=`t/H$dH+%(\HĠ[]A\Ht$(HSifLHeZxqD$%=HH9$u yHoiIL| H5z19O5@X8$VI1PHFLcPH531NX1ZfDX8UI1ɺyPHVLPH51NL1DIL ;XfAUf1ҾATUS1H8dH%(HD$(1I)$Lt\Hk L-1t$FALt$L 1UNHT$ H H9wPHD$H9tFHD$A1ɺUHD$L LPP1MHT$ L1[ZYx_HD$(dH+%(H8[]A\A]+WHA1ɋL BH5HP1PMLVAك8t+L 1ɺ]1LMrfL 1ɺ[1LLGYWfATUSHH dH%(HD$17PIHH-HmD$H$ExD$ WHD$HtTH11H4D$I\$AD$AD$HD$I$HtC HD$dH+%(u;H L[]A\ùL OH57KLE1P[VI1L H5KAWAVAUATUSHH $HH $HhHt$HH5: H=]HT$dH%(H$X!1D$LHD$hD$PD$\D$`XHIH-+11L HKH$HD$pL=_("HD$xIhints_veHDŽ$HDŽ$D$$HD$LL'OHH|$1A?#HtҾ L|SHtM97Hglobal_fI9PA?filtKHscan_lvsI9Hdevices_I9EHdevs_hasI9A?scanN=r'":AHT$pLD$(mH$HL$pLD$xL$HD$(Ht0HϺLD$8H5ȿ HL$0MHL$0LD$8:Mt&LǺLD$0H5 LLD$0GH|$(Hth1HL$`HT$\H5p KuKT$\D$`HHH HH!H H H HH!H H$Mt6LMHv(A}-t!1IuH$ SHSH HD$(Ht$HǹHAUD$hL \HPD$lPH$@!P1L$EHHD$8H LT$(H8HL$D$$HAI IBLLQU@=v%"iltef=k%"r:HT$h!H'ELl$hMtH5D%"L>RvL 1ɺ1HGLLHD$LRET$$AdHD$U1nIHD$AϦL$@LH譓IHQt&HHH9u HH9tL;xuLHCtIHL9Hp1ҹLQHuƄ$LKDL D$AT@IGHIVH@8H9M6L9t$Ld$HD$L9E1fDM$$AL9uLu 1ɺ1HAFH$X!dH+%(ZHh!D[]A\A]A^A_@=>#"rsioUf=3#"n:F1HL$XHT$TH5 H=#"HDL$TAH1ɿjLA HjD$pP1PEHD$0LH PN1ɺbHDL 1 Ef=k""er=`"":HT$h H"BLl$hMtH58""L9OqL 1ɺfD= "":S1HT$dH5i0D$dH=!"Fu;D$dL 1ɺ1H0DHD$f=!"h:1HL$PHT$LH5XH=q!"bF2L 1ɺ1fH5 @ID$Hth I<$HLHDL$LEt E9HD$L 2L9HLd$MHIMnI9t(M@I(HtLMM?L9uML 1ɺ1HABHD$f=N "file=E ":1ҾHItuHtpL  "HLMH1H1AU'L "LD _BHD$ Y^E1EDL8G|=".o1L "1ɺ"L HBHD$lHL' 1ɺD$PAUD$hP1HAAHD$0H ML! 1ɺAU %AсAL/ AQ1P % кPtHq1ҹLD$0H$[LLD$0HƄ$ Y1Ip!H$(!(LHƄ$H!+HL 1HD$`PDL$d1@HD$ _AXE1yƄ$'!JLE1K%J1ɺbHDLȶ 1M@HAWAVAUATUSHH $HH $H8H HQ:LF8EA dH%(H$(!1AAHAL$ A HA1L1LDHHE1L-HNHx.L@uAxtހx.uA@.9u AxtL$ 1HhLL觘xH$LSDuH$H;w dHA  >1<$LVM-HA?MH/fDHJu41EH$(!dH+%(H8![]A\A]A^A_ H8TEM1PH8LPH5`1'>XZHEHt7H9t2LH1L0[H5`=1WL BH1?ff.AUfATUSH8L-dH%(HD$(1D$ )$)D$HMooWHHH) $)T$gBHD`DDHLhHHH@HHtHPhHtH9uHT$(dH+%(u}H8[]A\A]ÐHHtPH9tKHHHHtOH9tJLHU1L QH5@H|$$:ID$XHL` D$DH@XHMHUH3NH3VH IT$XHRH9T$HL$HRHIHq(HJ(HH+H9"LJ fCIHdMt$HxHI$ID$L L%uMAE1H$dH+%(HĸL[]A\A]A^A_fDD$HL5NA=HDxDDHLBHID$hHHt L;b7fF HFID$hoMoUH'H-0H!HHH9t%f.HGHCH 6HHH9uHHHD$ uH[]A\A]A^A_tiI]xImxH9tL%@HS81IMHLguLIr1ɺG H5u0HH9uH[]A\A]A^A_Lr1ɺC H5uX0sAVIAUATUS>HI~LI1HI1E1IdžH)HfD<_tAALD4H9s AD-t։ڍKAt͐[L]A\A]A^4[]A\A]A^SH=HH{HI1HHHǃH)HAtJ11'fD΃31t,BHAt<_uۃt#vэBHAuƃL[3fȃ_[AWAVAUATUHSHdH%(H$HH9L5TAHtLpDE@ExnEDE`ut?AEDH$dH+%(:HĨD[]A\A]A^A_HED>Aąw=E`@F DADLDD1D4E@LE`EDƒH@D‰ƒU` EumH@ MH5 H G HDLv HDH9 H, HEHVH5NQP1)-U`H AU`LO8L H5NDAA % Ѓ=E9HA1P1E1,AYAZQ@ E`AA@L4n1ɺN1H5Nw,f6INjE`A?s@twAE+H1H5MMPLS ~1",Y^M`E1ML 11UH5M+DL12E@fe`ML 1xH5)M+D}@H=3xHE8H9D$(M1L-LL L@+H=aD $L01ɺ F$1ɺ L0H5aD $vcAWAVAUATUHSHHw40dH%(H$1gpHLhL5`IMM}MH50LM}L-c11LML A1HL=eL]H$E1PAƀ@HEL 1RLjP1_H EAH$H8H$oL=HL-zz\HLj AWI1LAL{XZL.1ɺ1LE1(_H$dH+%(HD[]A\A]A^A_@HEL 1RLjP1^H Et:H5 H  u4}0HD1wpAąEH H  u4}0HD1=pAąL-1ɺ1L4^yH$E1PAfDL-1ɺ1L-L]fDE11ɺLL]-]Lܴ^L<-1ɺ1L]AUATUS1H(dH%(HD$1D$f\$u/AHD$dH+%( H(D[]A\A]HV"tHt$ "AąDDl$ Et)11 DeDl$ D[#AąHL%/A1AUL L o\Y^H\$fD 8HDxD$Af.L+1ɺ 1H5/[fHAL 1U H5.[_DAX&$x+hH[LAPL 1UE1XDZ#,D HT[E18JEL P H5-.1UAYAZfDAWAVAUATL%UH-MS1HH|$Ht$dH%(H$1HGHHD$DHtYHH;\$FH LkM0EUI}EtJHuH11L*CLgZHuHD$H@HH;D$M HfHHt$$^ZfIEIUHIMHHpH9MHf.H;p6HH9uH9%1HH9u Ht$LD$41ɺLLD)H5YH$dH+%( D$4H[]A\A]A^A_D$411AD$01fDHt=HH9\$H~LcMtuAD$hD9t)D9DM9OHuHD$H@HH9D$tHH뼐EL$I|$EtYH Lt(1ɺ\1H5Xi1ۋD$0u  AA8Ht$$H=/KX"HKHD$ E1I$ D|$,I@MM6L;t$MMnMt{M9tEEIuEtEHI$HluLILD|$,HtDD$0~fDH5qJHD$LpHL;t$sLM$D|$,H1ɺAD$pL0} H5cfD$4I$HD$@AD$4AUPAD$0P1LL$@?WH IHH|$ /&H=Ht$ HPL.LL$ L΃ H5͍VLAD$4HA$LW rPAD$0H5P1LL$@VD$TH L蹸LA莭EtI$IDŽ$ID$AD$A L$$HAT$4At$0ML$E$A$I|$PAD$pPI$HPaH 2Dt$4EA$E$ElHD$Ht$\D$\H$ALEu"L#%1ɺ1H5keUHD$D$4E1HǀMt;MmL9l$t@Mt;MeMt2E$EADŽ$MuHD$LhHL9l$uT$4L$1ɺ1H5ȋTuDHt$$TYID$HD$ H0L*$1ɺd1H5rlTL#1ɺ1H5D>TfED$I|$Et1Hu3L#1ɺ1H5SDH=FHt$$ TI$Mt$AT$4At$0I|$MDa#AD$4ML$L PAD$0PH5o1gSY^D$4B/LD$@9HlM1LH5&SL"1ɺ1H5RLfZBHt$ L'LL-ROLtY IH51AD$4'LL$ L$ 1H5D>RufEl$D$4EUE\$ EGHt$$LpD$4$L!1ɺH5ʈQ|LHH3A}L~ 1H5$QrAD$HME$A$AT$4At$0I|$PA$PI$HP\H AD$4ML$Lw )PAD$0PD$41|$@,L$@I~XLIFXHHt$8AF|LAdžT$,HL豧M1LAv H5^#TPGHkLT$`DL$@ALLH5LT$HO#LT$H1|$@AR'H<L LK} LDH5"1LT$HAUOXZLl$@H5LHD$HHT$HHJH1H-"AUL HLdO^L_1ɺH1DO7M"1La| H5!"O M/L| H5!NT@UHSH/HHHt^1ҹHHHtH[]ƅI1 LS| H5s!iNH1[]1IH OHH45yf.AVAUAATIU1SHutH;@u[]A\A]A^I$L3Et.~HfL3EtHHBDp tID9u[]A\A]A^ff.AUIATIHUSHHHH}HmLHlH=>IH;HH?HDHHSL LLPH1AU}H HL[]A\A]HLH?H=IHt HDS1IAUE1Lz H56LXZff.AUIATAUSHHdH%(HD$81HtYHHH[HtAHf11LH)D$)$HD$)D$ 5HtHP tNH1MATLz 1ɿH5KXDZHT$8dH+%(uJHH[]A\A]HD$8dH+%(u,HzHHD[]A\A]@f.1Hzff.@H >HL@ LDH@HDH@HDL (q @LDLl@LD@tH q H5gHDHARRHP1P2H(ff.AWAVAUIATAUSH1IHHx(y;HHfH@ @AtAt AD$waI~ 6;HHf@Mt3L2I~LxL;HLLH HEHkD#I^HL[]A\A]A^A_f.L)1tH5I~E1 :fDLw 1zH5tfHELo 1H5DfATUHSHHdH%(H$1OIH#HH8uC8EH$dH+%( HĠL[]A\ÐH-1ɿ1ILo HLpuIٹ HLn \af.K;IٿIH:HoHDHH 4APH5]LvQP1H I|$E1l8L'n 1H5"fAWAVIAUATMUSHHH$H|$HT$L $HD$dH%(H$HGtstnPvfH@HnL Lu 1E1H5hH$dH+%(1HĸD[]A\A]A^A_@C`t H<$H$J,0HuIHu,1E1Lu H5uHt$LLHE1H<$C`H|$O$7DLLt$ϦAL$L%uA9$HHt H9L EHL濄1t$LWu 61^_E1LIvIHE11MGMK,/M)fD{@LHHcЅ"8tۃ taHH_H9 LJA9H lH E1PHrLPH5Z1QH LIM9DLC`}AoAoOAoW Ao_0Aog@E')D$ AooPAow`)L$0Aop)T$@)\$P)d$`)l$p)$)$EHT$!H01@A{t tD"HEt IDN tHH|$ D +HHH9LHHL%@11t$'L濄Lr AXAYH|$DK,7LϦLt$A֋$HA9$xD$E$I/$H|$LC?L4AŅD$VL BH 5H5jA9HEL BH9LJL BH 5HqjA9HEH$K 7LH!UH e5H|$E1L64AŅtlD$LHyH|$E11L4AŅtcAL BIL1ɺB1H5}(ML1ɺD1H5W'L1ɺG1H511;ff.ATUSH1HPdH%(HD$H1HHx0Ld$HLPHtLHh Hu HD$HdH+%(uIHP[]A\@HT$ )HHcH<HcHiMb1H&)Hg (yoff.@AWAVIAUATIUSH(Ht$HItHźIFI9rDHH9t<( tHIL$E1E11HL$1Yf.x?T$ T$ IHMAD@@t "t_ DHD$AB AGIH9s,At#AL;d$sEu uAGE1IH9rH([]A\A]A^A_fDAWIHAVIAUATIUDSHHLD$0H8IHHL$fIWL IELpHHH@H@0@ HIUAE H9u HH9tHPL;"uAE LūH;HCH|$PI]IEL(LktHt$PL.H[]A\A]A^A_LGH5D8L11LBn H581}ff.fATUS?/Ht0I}L$n [H5S]1A\%D>@HIEHپL|/L 0L`MDHHLE1~%x []A\DIٹLm {AWAVAUIATIUHSHHXHdH%(HD$H1GHXI@LLE;H{(?.IHH@ fL@8H{LxL.HHAA7Et#$AtECD>fBD>It$LH{LpL-HLLHHID$H{LhLo-HLHHxHID$ H I$HID$HL K,LfHD$HdH+%(bHX[]A\A]A^A_DyHD$HdH+%(6HX_ 1[Lk ]A\H5A]A^A_fDLD 1ɺd H5hd@H$HNHHDITHTHH)AI)AAzA1ƒI<H<D9r]DL 1ɺl 1ID$H5fL 1ɺn 1ID$ H5$ECD>BD>DL< 1ɺh 1H5cZf.L 1ɺj 1ID$H5*F!yff.AWAVAUATUSHhLT$L$LL$dH%(HD$X1HHD$I9IELt$ IHLt$(DLt$ @uc~AąuWL_DL_IH5 1HD$XdH+%(u HhD[]A\A]A^A_f1ɉHLAąVIEAuLHH ub@IPD$0AąL1ɺ1H5+ Jf1AtLHm(eCIUHHB HHHLIULh S\DHEH'r 5&H|$0H^ H HDH^ 1L1ɺIPAą1LAąIEH@@ -D$HE 'D$A;ELLABIH9T$ZHJAAtDJLH PDd$L 1LLh E)7HL$E1DLM$%^LW _AD$AELHMHH'u  AE$1ADžAuLAAEPIGPHHHˆH9ufDH@H9@tIE@L1LAąHM|$\H'r f.LHm(@IUHHB HHHLIULf S@AH@IED$1L1LA1rAą?L$HEtHtL|Aą,1LAąd1L貘AąHEA@1ɺHLlApL1ɺ1H5#Bf.LaO1/AH50IE1L(H51E1jDLHm(?IUHHB HHHLIULd SH5\1E1AXAYrf.LAą Ly1ɺ1H5/AE8LJ(kLJ(H5hLD$L >HIEHP HHHLIHSL\f.L1ɺ1H5Cbf.LHm(=IUHHB HhHH\LIULjc S{@L 1 LLc iLlL AL1ɺ1Lο-IGPHHHˆH9tfDHHBH@H9uLL1/AH5.轿IE1LO"fHT$L1LAą#L1ɺ1H5bDLJ(LJ(SL1ɺ1H5kfHEL1ɺ1LֿVfDL;IUHHB HtfHHt^LIH1SL ZH5臾XZL1ɺ1H5_LJ(LH(L1ɺ 1H5~*L1ɺ1H5Xwjf.AWAVAUATUSHhLH$T$DD$HD$dH%(HD$X1HHD$I9ID$L|$@AL|$HH$L|$@A9H$HVHHHEH@HtA@E9L$LXt.A|$LAEDD$DHH^zH}P1HCID$H@H'DH$@t C@xD$EuA$$EuEt$8A$D$ AD$$D$$ID$H@@u :HEPHHHˆH9u;H@H9+@tI$ID$AD$LHRJpAL$$MpAL$PADŽ$ADŽ$A9Hc8HH9T$HrFtJLHE麠PHA)L_ Hƹ HD$81XHL$E1HE1D$F_AX[H$H@H's1LH H}PL苿1L$Ht$(1D $+LQ^ 1EH5蔺E1ɐHD$XdH+%(/ HhD[]A\A]A^A_f.E1ɩAAE9L$L c$L1ɺuH5r1D $fDHLk(6IT$HHB HtsHHtkLIeH$H[(H@ HHHD $LD $SUPL] H51茹A\E1A]LJ(AUgL9\ SH51U[]E1HLk(5IT$HHB HtKHHtCLIAU]L[ SD$L1ɺqf.LJ(f.L1L9d$LDH$@@`HCL$A$@t9A|$Lt1LIH5iHHCfD eHH9D$$L$ HXDp8|$$xPx$}pHvH4IT$IHB HHHLIH1 AUL-L\ L豷X1Z11LHuC@t0A|$Lt(1H_1H@ADHLk(3IT$HHB H?HH3LIAUbLO SfAD$L2fDL-31 LL[ ɶ1L}OED$LETM$M$ 1IEH``IAH``=I|5I11Hg`H``A$tHO`HD9ufDH$H@(iH0x$L1ɺfLJ(H2 |LIHlLֿPHp$LQP1螵AZA[1HL$HLHI!H@H@fDH2 LLI1LN .HT$11HL`j$L1Lֺ1D $UDLA1/AH5#趴LR1ID$H51茴4$L1ɺx;f.LJ(yHEPHLHI9ufMRL9twABtHHCHE;l$LIL1ɺ1H51ݳHt$(1躳E1"fLQ@1/AH5!膳L"1ɺ11LHaXH$H@4@T$1LH\t$L1ɺfD$L1ɺ L1D $OH[(H/HLK SIMHLT$X/ LV IHHHD$(1yAD$LHL$8LHT$0pLT$gLT$HH9D$MH4$|$ Dp8Hp$|$$xPx$}pHpAl$L1HHt$[\Ll$0H5J I}HH5J HLT$8IzHL$ǸHL$HHS(LT$Ij`"Im`!AD$LH$ .H LU HT$I1RHt$8AAD$LLpt$Y^ jME`4$1LLIME`,LT$LtGAD$LLL$DhiL$1DLMB`LIMB`L$ Ld-Ht$(LDI1葰Ht$(11L$rD$L1ɺ[L1ɺ1Lֿ5E1$L1ɺE$L1ɺ $L1ɺHt$(L1ɺίvH\$(11L\H觯LC11H޿芯2Ht$(L1ɺh$L1ɺV踹cHXH;tL XVLXH5HH ЋXHTtHH‹bPWH=^X5X5rX]H8AWfAE1AVL=yAUIATIUSHHH(HL$L$ HDD$ LdH%(H$ 1)L$8HD$HHfD$fDOIѺAPLwS VLS$ 1ҾH _?1H$LŹlHUnLD$  ILF 1L21l$0H|$P1H1H5F t$Ht$Ht$HJH$Dt$pHD$(H$HD$ H EHILF 1AV6L*AZA[ϮE1҉ÅH<$t!H$LT$HxyH|$LT$LD$0\$@Dt$DHD$@foT$0ID$A$H$dH+%(YH(L[]A\A]A^A_Ƅ$ ML1LR (E1a E1҉ÅcH$E1D$ HD$LT$H%е8HL xE PHF PLPHELUXP1Ӌ\$@LT$0H fDsHD0D豲A}MLIHTH EH HDH#APLWQP1E11H pf.HL\$pf1L ]F L1L\$(L)$)\$pH$)$L\$(L "F HH@ H8t-L-U1ɺ-1LdLrH@8OWxKMxCH$L5C 1Lf1LL\$ H)$)D$pH$)$L\$ HItELP MtM A1t$AY^LT$@D$ LUH 跱E1ff.@SHHp蜠t(L@ 1ɺ-1H5q[fDHpHL)LL pHH5q1跦XZ[AWAVAUATUSHH|$PHt$HL$(LD$8LL$dH%(H$1HH5>HH4HD$0H HD$8fHDŽ$)$H-)$H HD$ H$`1HDŽ$H|$HHD$D$pD$tD$HPh$D$DD$L)$)$fD$DpD AljD$@HD$N$8bHD$(Ht$LH9lD$L$1LH$HfADڈD< HHuHt$tLtvHcT$tH|$LL㹁 1LHf.DшD<  HHu؁$id =DH;D$ RH|$1t$fD$pHD$tHDŽ$)$)$HD$PhD4$zfD$HcDH9D$ H|$1fHDŽ$HD$pD$t)$)$fD$id =Hc$ H$Lo$o$HD$X$)$)$$$ f$1HH AT tt HHuHseqno = H9$\1HT$pH5L6=HD$@ttt$p9p8%D$D$HHt$8DL$@L9HT$LHH9%<uL)E11IIIYHT$hHLL$`JHHHT$hLL$`HLHLL$hHT$`HT$`HD$H|HLLL$hB| AuB| u E1B| AĀ$H$fo$fo$H$)$)$HϦoL|$(H1t$`$H5MLG RFt$ P1S"D$xt$pHHDŽ$H0HT$xEt$HHѫM1ɺWLsG H5ǠE@HD$PH@@Hfx.H56: H诧IHL-!1LHAAT tt HH=u LI]IE1f.HS3LHAH9uL>[D]A\A]A^fHGHt H L[D]A\A]A^fHGIuHtH IUAuL=LD`[D]A\A]A^DIUAuLA踝[D]A\A]A^@EeEUE11ۉLHIDHP0AA;]r&@EeEE11ۉLHIDHP0AA;]r@EeEE11ۉLHIHP0GAA;]rE1AWAVAUATUHSH6H9IH=H HcH>LuA$E|EA/@H[]A\A]A^A_@A$LmHHAttHIT$It\ A$HATuA]SAU0wHLD$RD$@LmLIuE]ESIUELD$HU踛D$3fDLmHL)EMA9AFK1DHH93A\A8tfLuAA$1H9AA8T6uHMnIT$L5DHELExAD9?A[LuAIA$1 HH93AA8T6uHMnIT$LtiDHFD2EAD9pAHLD$OD$DLA9LHGKuGH1[]A\A]A^A_fDHULD$RLD$AEnfEUESELD$D$;fDAIIT$HHeDHB2A$IAD0IV /w A8s HH9uADH߈D$PAPAHLIOD$I~DD$PADLwPAD$[LD$辘ED$2I~DD$8PADL%PAD$AWIAVIAUATIUSH_HHGIAnHtHX;(rv^HXHHuAM,I(Ht`fH@ @(HM9u3L` H[]A\A]A^A_HXH@QHttىmDIHXAnfHH11[L,][A\H5HA]A^A_%iH~AWEAVIAUIATUHDSHH2DHA2A9wfHSEHDSAHD9tH;uD9w2@HUEHDUHD9t)}u1H[]A\A]A^A_uADEu,֐EtHEHSEHDSHDEHHAtu'EuEH{HuHE{HEu`2u uuIImfff.@ATUSLgHHO I9A$Il$<^&<#~*P܀:w"H5A HcH>fD<|H{C1HkHHA $Hs []A\H9LO8 1H5aC[]A\DHkC[]A\Ho1GHHHnHCH[]A\HHHA|$^1:1LS L9z1ҿfAD!IiL9[M]\-AIAHHKuD HoGHHH螐HC`[]A\Ho1GHHHhHCH[]A\ULMrtn}AAHFLMM9|M8|ЉʉLCI,A EAD#]AEÃE8}DA A I-A A  I9HCHkID$G1HGHHH AL$rtFtt!nt,Hs 2HCH"HCHHCH @Il$虎HC`O[L/' ]H5E1A\% ff.AUIATIUHSHH?Htwf@Hþ1fCH}L4 HHtJ1LHyH߾xTLeIm I]H[]A\A]LY4 1H5`; H1[]A\A]fDM1LB4 H5_ H1[]A\A]AUI ATLcUHSHH?HtwHH@@ H}L3 HHtL1DHgH߾ xVLeIm I]H[]A\A]fL3 1H5^+ H1[]A\A]fDE1L3 H5^ H1[]A\A]AUI ATAUHSHH?HtwHH@H}LG3 HHtP1DH_vH߾ xZDHEIm I]H[]A\A]L2 1H5] H1[]A\A]fDE1L2 H5] H1[]A\A]AUI ATLcUHSHH?HtwHH@@ H}tL2 HHtL1DHeH߾ xVLeIm I]H[]A\A]fLI2 1H5\ H1[]A\A]fDE1L22 H5\ H1[]A\A]AUIHATUHSHH豍LL`LHt-LHH菖HCHC H[]A\A]1LGVH5\; H1[]A\A]ff.HAVAAUMATIUSHwHHubf9.tL@Hs(H HtKuƒtDtMLD6Vt[]A\A]A^@Hvf.[1]A\A]A^1fATIUHSH?H RHtEfL`HS(H{(HhtWHHS0HPHS0HHC0C []A\1L0 "H5/ [1]A\W8ATIUHHH׋LHHIHt!H@H@ HL]A\fDL 1H51k fAWE1AVLcAUMATO$UIH- SIHLHA$dH%(H$1IL$AD$At$ LHubD1HU[IHtMH81LLHx%DH$dH+%(+HĘL[]A\A]A^A_fKHHE @H8HmHxHtIHt|H81HLX0IE HH8Hx|LLCVM1L. H56|@E1I1L. H5{詄LE1yL511H5{xގff.HHtHff.ATUSHH $HdH%(H$1H$HHuIL1ɺMH5 H$dH+%( HĠ[]A\fDHHexȅuMH-H^t 58ufIL H1ZZ |D蛺H-CtILF- 1HQ1 DL% IH$IHHxH ǟHDHVAPL6/QP1AH !AWAVAUATUSHH $HH $H8dH%(H$(!1H$ HIHHAtuPL1ɺi1H58. H$(!dH+%(H8![]A\A]A^A_DL$ LL tILL蛌uOD$%==`Mw1L+ H5 ]L=EpLH譏H1IAVLL ; XZ@EuSLL= yÊ8M1L, H5 D#tLH脋yk8HIL4+ 1AVH51 AY1AZH9F@8HLIAUL+ 18 Y^H$L`uP$%HSHL(+ I1AVL1 _AXTwH 8蹆$ MIHWH(HDHH pAPH5zL+QP1H 2ˉff.ATAUSHH=m!dH%(HD$1H$jm!JHH=j!HIHDHHL%1It$LL*  XZH<$͈@H- 8肅;HH )HDHIPH LPL*1RH|$ H HD$dH+%(ZH[]A\L%1L&* L H<$H<$^@l!yl!fD11?H HH7H L%x8rL LI1AH-D L%<86HLIPL( 1Y^L1ɺ1L @蓆H- H- 8΃HWU-ff.fAWAVAUATUSHH $HDL$HAHH$AAEHdH%(H$1uuQL1ɺH561 H$dH+%(Hĸ[]A\A]A^A_AIHt$HI I IM D$(%=`L;t$8tHL=xtOL=8D`H+1tt$LHD$ `軂y8?|$ >11DDH_IL L1B fDI1L2% H5ҿ $L="IL& 1L-1| Hi d$H IIHH 'HDH)APL&QPL1H L% LIPL~ 51SAԋ|$ЇX1Z1ukH 8譀$HVIIH!H ; HDH>APL%QPDӃAWAVAUATUHSHH8D$pLl$xT$L$D$$$DD$D$($DL$ D$,$D$$D$~LI}LHD$ rF!t L=L%M7M9DfDH|$HR|IHXLxPD$HAD$ D$AD$$D$AD$(D$ AD$,D$$AD$0D$(AD$4D$,AD$8D$AD$LDD$AD$H6}HLLpL$M|$LM}LLHPHE!M|$@H=HLH= I$HID$L L%H8[]A\A]A^A_fIwH\IMM9IAuѐwL=L%M7M9IwL豁t'DIMM9qIwLI芁uLH= wAGILH D!,IGHBH{먋D! C! C!L=L%M7M9uDIMM9IIwHuLH=. AGILH C!,IGHBHB{H kC! kC! iC!DLH= 葢AWH6C!L,IIGHBHz?L$1DED$L$D$-'H8LR" 1[!]A\H5A]A^A_% ff.HHHtIHH֋HPLQRB! B!DH1蹁H@SHdH%(HD$1t_,fuHD$dH+%(H[#tHt$M ju&LR1ɺ H5 @t$5uH AٹSL8! H5[V XZZ~f.AUATIUx5L-xA1ɿ1LLD!  uu]LA\A]xfD}H- 8zHLPH PH? L ~ PL 1LH ]A\A]xff.AWIIAVIAUATUSH8dH%(HD$(1HtHMtILE1ML-$ HÃf.&4IcDL>f.ItAFdMtoHI 'u_؃HT$(dH+%(H8[]A\A]A^A_A1ft7Ht-DHH 'tLA܍MHÃ:DMif.Ht$ LHT$LD$L$ %2L$ LD$HT$DIHHfDqDLHT$LD$L$ L$ LD$HT$'LHT$LD$L$ JL$ LD$HT$LHT$LD$L$ ZL$ LD$HT$LHT$LD$L$ HT$LD$L$ LHT$LD$L$ ZL$ LD$HT$gMIL9L1@HH9uHT$LD$L$ L9ɍICH5YHx({L$ LD$HT$fDMIL9qL1@HH9uTHT$LD$L$ L9?ICH5FHx({AFdIH IH9HxXHAFdIIH9HpL;vXHH9uIF`H!IF`H"IF`HIF`HIF`H/IF`H.IF`H'IF`H&pIF`H `IFPH@`H L@IF`H68IF`H  IF`H3IF`H2IF`HIF`HE1E@IF`HAFcMI?H,fIF`HpAFbcAFcSIF`HCAxf.AWIAVAUIATIUSH(HtHMtIE1ME1AL5 fDMLHIL9IDIc4L>H@H5LL$HT$Hx(D\$L$iwL$D\$AHT$LL$E1D*HLAHH t_NfDH@H5)CLL$HT$Hx(L$D\$vL$HT$ALL$A7HuAH(D[]A\A]A^A_DH@H@H$T@IE`H@IE`H0IE`H? IE`H%IE`H$HH@H#xH@H@MH@H@H@H@H@H@H@H@H|@H@H@ nMuAEdD@IE`H10H@H@H%@IE`H-AEfIt0AEdu)AuHAH@@uvMDLHI HpFxLI|AEdqA]DD\$MuI^AEdSAb?A(ff.1AT(‰1Ҩ0AƒE‰ƒ@E‰ u E\t IcAAA~IHtULiuEuAE1fDMcLB<ILh1LHfDEu3H$dH+%(u@H[]A\A]A^A_fDE1bMcHH5 1B<rhpff.ATAH5#`UHSpuPHAtHcH HH)HTHtQ[H5:]1A\gf.H5Hou5AuH ] HH)HTfDH5;HYou5HApAt Ae>HQfH5Hou-HA(HlAH5HnHLAHAiff.AWAVIAUIATUHH׺@HPdH%(HD$H1ILH~jwlAMt/D%H Et#D%EtLLLH>AHD$HdH+%(uyHPD]A\A]A^A_Ayι 1E1L H5.cDAL11z H5-bwZmf.AWAVAUATUSHHdH%(HD$81HIL51fHHIL1L)D$)$)D$ HD$$fHH@ H8ML5] 11L<-L) HH1LPL 311L AZA[1E1LH5,aHD$8dH+%(aHHD[]A\A]A^A_L5 k@H@8OuxKuDpEuH11HL)D$)$HD$)D$ HtH@ Ht DEHLK11hL OLH5  _AXL#1H5+` fDAE1LH5+`LxAtHL5kf11LL)D$)$HD$)D$ H:H@ H-84ML5P 11L/-L HLgL1ARL 11L L9Y^MD}MtuHHf11HL)D$)$HD$)D$ UHt@H@ Ht78IL11-H5 i fHAV1ESL5 1ɿH5*A,_XZXDL5/ @Lp)HXHtH5BHfHtA $H57HeHtA $H5'HeHtA $H5HeHtA $H5HeHtA $H5HeH A $ hAUATUSHH5dH%(HD$81D$t Vu"HD$8dH+%(HH[]A\A]HLHLKbHKH5JH|$jLc1AUL H R1ATVH5kUHl$XH0|$HL$HT$ HD$ ty4PI1L  LH5%(A]XZLd$ Ht H}謿HD$8dH+%(uHHL[]A\A] bugDUHHtWu H]uH]rfy,L>1]lH5{'\]ff.USHHdH%(HD$81t u"HD$8dH+%(HH[]HHHtH9=tH5@HftH[(c`HH|$jSLc1L 6RH ;1H5ZUAH\$HH 1ɋ|$HT$ HHl$ Ht H{HD$8dH+%(uHHH[]t`eff.@ATUSH@ dH%(HD$81t lu HD$8dH+%(H@[]A\Hx_1H|$E1LcH _H51f~Hl$(|$1HT$ HtD$ y$Lc1QH5%ZLd$ Ht H} L_ FH-I%1[Ll HOZHD$8dH+%(u(H@HL 1[]\A\ZdfAVf1AUL-ATLUSHH@dH%(HD$8HI1)D$L)$)D$ HD$lHt?H@ Ht68H-M11L-H} H-HH1HPL {1L@1@ A^XHf11LL)D$)$HD$)D$ ĴHtGH@ Ht>8H- 1ɺ-1L LH H-HHnH1PL 11L A[]HH-f11HL)D$)$HD$)D$ HH@ H8IH-J11L)-H HL51HAVL1L 1 _AXHf11LL)D$)$HD$)D$ hHH@ H8 H-1ɺ-1L L{Hm HH1HSL w11L7< YI^H1AVH-[LZ H WXZHxH5epafWHH11HL)D$)$HD$)D$ hHH@ H8H-I11L-Hq HH 1HSL c11L;@ AYIAZL ~HxH5SW`fHH11HL)D$)$HD$)D$ 舱HtCH@ Ht:8H-I11L-H H-HH81HSL {11LSX A\IA]L {H-v1H*U= HD$8dH+%(H@HL 1[]1A\A]A^TLHf.H-S@H-@H-7@LH^LHPLp^fHtHHtH9tH@fH AULcATE1USHHdH%(HD$81D9O t&HD$8dH+%(xHHD[]A\A]@ HLŅtXHcIH= H H%L H ȉ$HtLd$HHLI9E1wDHjE11jjR1H IHD$$EuL|1H@PH1HAHR^HuD+E1tyhH@HHXHp(H1HA ^HD+fDL\1ɺ1H5Rf.H@\DAWAVAUATUHSHD= H|$ L$t$(dH%(H$1AHG8AAEt=ȉ$H L$Ht L$HxLLI96DEEj jAE1%jA1D 1L PHD$XH H? D$Eu>E1H|$8H$dH+%(HĨD[]A\A]A^A_DHD$8H@PHH0HL$XL$(ʃtD$Eb tD$E DHt$XH|$ IEHL$4DD$0OBHD$8D$,L5H@HD$HfHD$HHHHhLhH@ HL$HD$MD$(L$4T$0 ЉD$D$(tH5LZLLZD${tH5<LZHD$ E111 11HP8jjAj A%A 1PHD$0H HuSI M1HL$pHT$lLLL$xLD$tH58 QYIH HuHD$HhHLeL}Hm MtLLYxH5;LYuM,1HL$pHT$lLH5*aQot$p|$l1AHwH|$ fDLLYAąuVH=d %HHHt$HT$xHHD$xHXɰ H5' LQ4H5LXAą|$,t.H5$LsXtH5L`XD$,H|$(D$(t t$,A'E H@HHHP(HpDLt$ EIALgLADžEv8cAĉD$0ÉD$4gt$p|$lt$x|$t1tf.H=HHHt$HT$xHHD$xHx8HtH5WHff.H=lHHWHD$ E111 HP8jjAj A%A 1PSH IHH@Ht*HxHt!1HL$pHT$tH5"YNDMH1AHD$(L5L  LHP8A A%A кlP1KLHA[[HD$ HHH;D$ LHt$XdLAUL1/KAXAYfDD E? H$1H|$PHH=HD$@HHt$H|$@HT$x67HT$x1E1L=zH\$HDLd$ DLHH1SL LgJXZHT$x;ZHrH@H8AtI$HtL9uL DHD$ HL 1HP8A A%A кAP1H5IA_XH|$f.H\$HHD$ E111 HP8jjAj A%A 1P蓽HD$hH Hm L`MLl$PL=2I MID$I$I|$Il$I9Md$ H9!H„tHtH5(fSLHOHt@tH5͹HOHt@zH\$ HH H9 LHL5[L 1 LeHH|$HH|$@ѪH@L1ɺH5)HH衪@L1ɺH5ԊGHqL1ɺ1H5GLjE11j11 j$PD$ŻH IHHpHtHvHT$xHHD$xDP0E$@8LoH跩(LΈ1ɺ1H5GL5ۉ1ɺd1LLEFkHD$ HL1HP8A A%A кHPB(HB08AgHL$ HHt H9L - L1H5)IFEL݇1ɺhL51LFH蕨H\$ AHC8 % H HH9LIRL51ɺPL1LEH%HD$0ZYHHt H;D$ L D t$X\LAU*L1ɺ7H5$IELl$PH|$HeH|$@諧L5L1ɺLEHD$ HHH;D$ wLHHL9Lt$`3L | LS1ɺ1H5vDH|$@ NL#1ɺL5H1LcDH|$@٦P1ɺE1LH5 2DH\$ DMAHHt H9vL ǵ L5ֆ1ɺ{1LLCL HSYELg1ɺtH\$ HHVH9MLHHt$`LH5P1nC]A\H\$ EHHH9LHt$XWL0AUH\$ HHH9LHHt$`LH5ą1BAYAZSH|$ H\$ HHH9LHt$XQLYAULHLHL ? %LHL * DL51M1ɺxLAǿL18BL` H訤H$HDŽ$H\$PH$H$HHDŽ$HDŽ$@HH$D@H$1H$H$HpDŽ$H$H$ L|$@L`IHH@fH]FLHXH.H{t$nH$ID$pH$H|$PID$H$I<$L HD$xL$DŽ$ HP0BRHH H H%H 1H$a  @H|$@L5:ߢVH@L L +L L pL51ɺ1LL?H|$H# H|$@iL1ɺXH\$ AHHH9LHL1.H5l?L @ L1ɺH$HHLHLHHHHH)H)Ճ&1҉փH|5H<19r L ϰ ZH\$ HHt'H9t"LHHqt$`LL Li1ɺAID$LM1ɺ%TfTH$ۉTT\HAHuSI1HH rH+贗AHEx [1LbH5=1[AWAVAUATUSHH $HXL={ dH%(H$H1Ld$@AIIHI;LHL L1ɺ51L1{DŅI?L@HFIƅHcL11JA>IEAn>H$HdH+%(HXD[]A\A]A^A_1IMLHL1x]1L1CŅ6BFE18CM1PH0L~PH51[<_AXTLe1ɺH5t1E1,<(8E1CM1ɺPHLU~PH5)1;LA>BM1PHL~PH51;XZ@B1MẵPHE1PH5L}1k;Y^VEff.@AUATIHUHI@LLhLIHtRLHH$IE11LLQH HH55+HtL]A\A]f.LA1H5:f.UHAWAVAUATSHXHLHdH%(HE1HHI9WAD$LHI%HHHH)H9tHH$H9u%H)HH&L>HHID$H@ .HHHHH HH(H H0HH8H0AGctIGPHLfH辞AƅcIH9VH@@LrAƅL覵LIH5%}18)f.LHHID$H@ L1IT$HHB HHHLIHLSH5|1/8Y^E1DHLHHHL0HH5ϛUBAƅHa@HIGPHL%{LLLAwH1v7A[L[1LS7IGPHLLAwH1L 7A]L1A_L 6L1L69f.LxL,IH5z16HEdH+%(5HeD[A\A]A^A_]@HLrDLJ(HzLw1ɺ~HHƿ1-6AD$LnE1LE1MEDDH@IHHDEIHDEL`MID$`u}HFHttH@`uiubHLL9LIHLfHI9HsLXtLHfDAt2AIHDHH`IHDHH`AELAA9EMLE D9IUJD9s; B DžE11DHLfDLk1ɺRL.HPHHHH@PHxRIHHtAAlHLQIL$HL1HwLj1ɺL-L`HLH@PHx讋IHFAAEtAAAHLIAL j11H5lM(Li1ɺH5}l1'(L ۙ 1ɺALiH5Cl'NLi1ɺ1H5"l'(HP(LL,AƅAIIxLHIILILLH) H)H9LLIGPHHAt$LL1LHD)MxAƅHLH;unHL9aIGPHsH8AƅuLih1ɺ1H5k&HAHLBIH5j1q&HA LbIH5j16&L12H5aj &gIIxLHIDITITLH)A H)HJLng1ɺ`1H5j%-LHg1ɺ1H5iE1%AD$LE1bLLM DIIAD9%IDEdH[ хuIDEuL L;^BIIAH5+LHHBHDLHIqIQ1DLLLB`LIyoH0H;AHHCH5HHBHDWKHbHS1DLLB`UH{AGLML*HLHDžڥHLC Lge1ɺH5g#zLCe1ɺ1H5g#HH;6 Le1ɺ-LLzIH5}g1'#AAADADLd1ɺH5;g"I$LlAEACD&CD 5ADfADHLADLHIy1LARISH5f1Y"^_1ɺE1LcH5f0"HHAŞLHIy貞APILS|1ɺE1LucH5f! 1ɺALNcH5e!ECD&fCD fDATUHSHH+AHEL%HL+AHEtmH5H+AHEtSH5H+ALEt9HqHHl+AHEtHHR+HHD[]A\ATUSHH-8Iu L[]A\DH%Hh HCPHHHxiHHtMHH HH1L% yLI[]LA\ff.AUATUHSHHHGH9HHP Ln(HtYHHtQIH}蓜HILAUH5 dATP1H H[]A\A]@L`(f.H7HUIHB HtwHHtoHATIٺPLS1H5c@XZH[]A\A]H1[L]A\H5ScA]fHB(f.AVHGAUATIHHW(AD$ UHESH8+HPI$IT$HPL"L`HtlH8HHL5}EHL"1DH)J|5HGwt'L_#H{8LLP tY[]A\A]A^H-z1ɺ1L_H 1ɺHL_[1]A\A]A^L H5ː[L[_]1A\A]H51A^ftXHFpLFpHI9t^H9PtL HL9tMLH9PuHH@HAH HBH@h@HLHI9uHNHHHBL LH5H@HQҺxPH_LE11HHHH96:HB`ff.AW/AVAUIATUSHLHLwPLLt$Mj"IHXHIDI9ufDHmI9LuHIFHxH&uMehMtIt$A<$LiI]pM}pL5 L9uADE$IEPHHBH@hHL9t\HSMt E$EtIEPHHS:HBuHHH98HHB`L9ufIEPHMHUH@HQH H@HHHuAHUHHH*HHHD[]A\A]A^A_HxL(D$Ld\1ɺ H5݈1DL$ID$H1LLcLHHHB pH1oAXAYD$L[1ɺfHD$H@L@I9ugfDHmI9tXHEHH@HxH$uHD$H1LPH5LAW1XAZHD$HH5LLAW1YE1^f.ATHIH@dH%(HT$81H|$HHH=LL$HDHt$ H$HT$PHT$PAEHD$8dH+%(uFH@DA\fBT@LLZ1ɺ 1H5Æ"AWAVAUATU1SHHHH$Ht$T$0D$L$4LD$(LL$ u LMHtxHD$D$HHD$@EH[HtH;uLKAY<@tUEtL1ɺ8 1H5H[HuE1H$AHHD[]A\A]A^A_@AyUEuAy*MymHD$LHD$L9LH\$8LIfDHI9HsL!uH\$8Ht>LuL9IvL!t!DM6L9IvL`!uH$Pt$H$1LOdD$f.ELX1ɺ1 H5h\L1ɺ* 1H5s?3f.E L1ɺA 1H5:AH$HtfHD$L|$LM9HED$H\$8HMfH9IfDMmL9IuLuHD$H|$ H@@~HHHH9HBHLe ATL$@QPDL$TH5E1A H ZM6M9DH\$8D$fHD$LL;t$DD$Et)IvH$1LM6L9t$H$1H57 uL]AƺN H5WIMID H\$8.H$1H5迤VLAƺq H5&GD$HL$(HGHt&HI@H)HHH9HRHtHHt H9tLIL C RLS_ AT1H5AVXZH L$Aƺv H5RsHtHI@HHHtyH9ttHRHtHHt H9tHAH RMLPb MLAƺS H5ˀHK H? HD$H|$ Hx@tIHHHH9H@HL AWL$@QPDL$T$uhHL$(HEHt&HQ@HHHH9H@HtjHHtbH9t]HRPMLR A;L jEHHD$(Ht Hx@IRL[~ AWH+ H" H pATE1E11SHH1AHjSjH t HD[A\fAHC011C8LR H5HD[A\fAVAUATIUSLA8H1LsuLIHL5 LLH|LHlHLsIHtd1HH1MLHhHLixi[L]A\A]A^DrIHtL[]A\A]A^L1H5 f.LKH5߮1E1k@ATIIUSHHHgdH%(H$1HHhHJLHXHrHts9ud@H$dH+%(H[]A\DH$HxHHHHLHLHH) H)։Hf$tTfT@1LdH5l1UD$ۉTT<AWAVAUATUSHH $HXdH%(H$H1HD$0tu/H$HdH+%(HX[]A\A]A^A_fDL- HM9m*tL=A11LL H5vH=XSIH10HD$8M9m H|$8 IHKMLAH1OM9mELH=D  D$D$ϦELlH1LcD$$LPDL$1 Y^Lt%51ɺnLDL1e a0WfDH!~ H9DQ EH|$8~ IHKMLAHF1&L1AH=LD$0H߾!LLD$L-? Lt$0LLHMIE1 LHT$ HLt$0LLH޿MIE1 LHL1HU 1ҾH&t-Hu#HtHHL1 LH=p1D$IHD$@D$ϦHD$Mf.LHWIHAt&HHH9u HH9tL;huLHouKAEbtIEHt L9L { .L1L ffDIEHKL9BHpH|$1ҹHuƄ$?H|$Ht$|$D$D$AE`MLLLD$ LD$ H =HtKH@PHtBHHHH9HϺLD$(H5sNHL$ HL$ LD$(H<HDIE8HH 0 HH IHIEAA Ht L9Lz QLLѾR1H _AX @H5Qz @Haz H9D ELI1ɺa1LCrfDDD$L$1HռLI IFHth I> L LH=fHy H9IEHL9LHL1ɺ@1L@H-H9  H1UDL 1L7XZLPhLHL x fH :cSG`Ht@gC`HcCXt9 ~H {TcHCT[ÐHHt H9L Hx 1LCH5YvdC`gC`HcCXuHHH9LHL1[JH5 v@HHtQH9tLLHH1Lͺ1RH5uQXZHCT[fDLH/L iw L Yw [@AWAVAUATUSHH $H8T$DL$dH%(H$(D $x vHIADjMHEPH8rt! S _ HEPL|$ LMHH(LH0L1HhC^kHEP11LH8JIH@`t Ā̀AF`[ u  UEw$xCHEP1ҾOH8HŀH8r1LIv"H޿1/fHD$脀L8"IH5q1DT$H$(dH+%(VH8D[]A\A]A^A_@3 wfD#p ^LMHM"LsH5^q1(E1xL8D$ HLW"IH5q1DT$ +$xHpAHEhHM9MCDl$I9LGDHIHEPLHDL$Hxj6i_AXAUAWILe1ɺ"H޿1/D` AYAZEu |$MI 1DLL PAFaEHu`+A,@ADMR"L lHHoA~1ɺ]"HIL51qHEPj1ɋ$xALH8RDL$L8GA[A_D$OAFaDT$HDT$}DT$HŋL u> DT$HL ߵd"HLBLDH1UAXAYDT$fDIHL9LH1L1ɺH5cpnAvXH=3 .LfAF`DMI IHD$1Ll$HD$Mu'HT$HD$HHT$L9HL9v LH)HD$A~T1Ltn 8tW1ɺ"HPH%^LAPL 1YL^1ɺ"H޿1ffDE1K NHEPHLHDL$HxjeHIXZ{Hŋ> >0 L LQ"H޿H LDH1ATAUUH E1AvXH=e `LL 9p @{Hl1LCIp"H޿1DHLehzHIHEPLHDL$HxjdA_1ɺ"IXj1AULH޿  XZ{ME1I L.@12H5*@L@12H5@gDT$]AvXH=" LUDT$fDAWAVAUATUSHH $HE1H|$HHt$hHT$ L$`LD$xdH%(H$1H$HD$H$H$H$HD$@H$H$HH9tHAH9uL=pl1LbLeHD$ D$dD$tD$pL DH M,$1XL9d$ I|$G`%G`mLMIID$1҃H= pXI$ID$HBHH$ HD$I$H$ID$H$L(IL$ML9t$ I~G`%G`MIexXID$HHHH9HJHP8QLLMA A%A кP1I$ID$HBHID$IH` AYAZL9t$ tI~G`%G`9D1ALIL}L$I$MHD$L;d$^H$HD$0@ID$HHH~H9uLJL1LܯIt$D$pD$dN` HHHtbH$Ht|$`uID$H=| pXtI|$I$ID$HBHH$HD$@I$H$ID$H$L(L$Ll$IEML;l$;HD$ID$LD$011H= HDŽ$pX L$H$H|$(IpHLIL$HA8yX % H1HH9LNHLLWRP1xIl$DŽ$H HD$he`Ht1H|$HHH Lt$(Ll$P11HD$8HD$Ld$XMAHLABELONEI9$]EtID$H9It$ϦRA;D$WEfDHIHuH|$Ll$PLd$XLD$8HL$(HL$Ht$M`LH|$HH HHP$HEHHH9H@HIL%1P1LID$AZA[HHHH9LJL1LD$tD$d @HiL(I9I}HLHuMmH?I9uDHEHH9H@H8I1PL1L!XZENIEH\$8AHD$EDHUHt_H9tZLJS1LLIP'1Y^L yg @L ig @HYg N@L Ig HEHt7H9t2LHHLL1S#I_AXML f L61ɺ~1LAHD$ L L9\$dLL\SD$|PD$1Y^HD$xHtHt$@L肥H$dH+%(H[]A\A]A^A_fHEHt/H9t*LHL1ɺ/1LA@L e HH9LHHLG11RLID$AXAYHfDL e @HEHtOH9tJLHH;1SL޹LXZf.H 9e K@L )e He 1@L e 2@HEHtgH9tbLH= xLL11HHH5HHtxfC CL d HEHt?H9t:LH11LLuM`@L 1d HEHtH9ueL d = LL113HHHaHHt褉fC CtLHH _$H567H=G7BfAVAUIATIUH8dH%(HD$(1D$ HLt$L`HL0LpHD$HD$MtAD$auA11LD$ LLHD$(dH+%(uTH8H]A\A]A^*f.At$XH= LHD$(dH+%(u H8]A\A]A^T@AUIATIUHSH4tpI]I9uCDH̀A`I9t0HKA`tqXH=\ WHKHA`̀A`I9uHLLH[E1]1A\A]%DH1ɺ:[L1H5`]A\A]'AUIATIUHSHtt`I$I9u3DHI9t&HCHt@atpXH= HI9uHLLH[E1]1A\A]uDH1ɺ)[L+1H5l_]A\A]wAWAVAUATUHSHH8HL$dH%(HD$(H6HD$HtHHD$uLQHxE1jH|$ HDAuEHH@HL4ЋUPAIFHHCAHXELH2D9 ;0LkMCAMWHEL{LpPMVxMLLT$qH|$HL$ LH蜲4LLHHPHHCLD$DHH,:D$L/11H5ZDL$D1MH5 L#HEL{LpPLLrHYMH7LLDH1t$ L۰H5ZMLXE1ZHDL.1ɺH5P[!L.11 H5YE1HD$(dH+%(H8D[]A\A]A^A_LL$LH5cY1E1fLL$LrD9wAsLL$LLL$LJ{DLL$LZ[AVAAUIATUHSHGHHxNIHt>LDHH-^t[L]A\A]A^DHCLE1HxbL9]1H5M|AMDAWIAVMAUIATUDSH1HH8HHL$HL$dH%(HD$(1D$LT$HIFHP(LX(tJH@HHtAIL$@H9t7HIL$ LM\$@H<H94))4ID$0HLH uXMOIHCL9:H@H ME1P1LH5LWZYIL$ H<1H9j1HL$ HCQHL$ QAKL\$QH QHHLWLQLV1PD$`H@L\$HIHHHHtH9tzHBM PL1AW H5KAsAQLKH Mt t IL$` HD$(dH+%(H8L[]A\A]A^A_fDH[ Mt AMHHtHHt H9HZ M PL1AWH54K1AsAQLKH ZfDHHt HHtH9uSHlZ HMPH5JL1^_fHB_HBf.H Z ff.@ATSHH $HH@HOdH%(H$1HIHhAHAu.H$dH+%(HD[A\fK8t0I1PHcL)PH5H1bXZfD(1E1LH5H1^AWAVAUATUSH8H|$Ht$HT$(HHyD$$11H|$E1E1zfÀu_fIM ADA@tI"tD D$$tHD$(AAB _A]EHD$(D$$AAB EHH;D$s>HT$L,A]t,EL;d$s" jEaEE1HH;D$rH8[]A\A]A^A_fD$$fDUHH $HH l HU>dH%(H$1HIH7?x+H{H$dH+%(u3H]L$'1ɺ1H5 gATUSHH $H`H F HdH%(H$X1AI@A AH\$PD$ AAHA 1h>H5HHHaLd$H¾@L0H1HT$ H5Lu.uA~.u A~tfD1MLLH;L$ 1ɺHL$ pLH5gLIMHHHD$HHL$HxDIH'HL$HLT$LT$&H$(0dH+%(H80L[]A\A]A^A_f.ML611H5L"1ɺH5@E1C<7 uC7_ILL9wfDH$ IzLHIITITLH)H)ƉH@$ AATfAT8$Lz"1ɺPHPLL$(1H5XZLT$L1ɺ1H5E1j$ AATAT5P8tHĐD[]A\fAL911H5~|1ɺ E1LH5PS놐HtfDSHHyL8t4I1PHLZPH51XZ[f.IL!11H5[ff.AWAVAUATUSHH $H8T$dH%(H$(1D$D$D$D$Ht6E1H$(dH+%(fH8D[]A\A]A^A_AH=EH5HHtD$ E1L|$ DHLXH_|$ #tA?pvidA?devsE1HL=||H<Ht$L$T$D$EATL LS\$SAVVLQ1RP1"H@ffAs:HA =1HL$HT$H|$'H5$LK$D9t$D$9D$ D$ @fA: 1HL$HT$H|$&H5K9\$D9d$AmDATL LS\$SAVVLQ1RP1H@H=81LPHL PL(1XZjDc81LPHL NPL1Y^ D#l$ fD 8T1LPH_DLPL 1'_AX8 1ɺLPHlL PLC1AYAZBAAWAVAUATUSHH $HH $HXL=O: HO<LdH%(H$H 1Lt$@IL1Ki 5z LHHHD$0.H$fDHHPLh9uA}t@9uAE9u A}t@H $1HT$,LH56.1MLgH5ȅHHvDHH$H dH+%(HX []A\A]A^A_H= 1CHHuPfDL8H1#HHu@Dl$0HcD$,LL$8Ht$4H=x LLL$D$AHH IcH H%H HT$AҺADT$4DT$ߚLL$DT$taHt$8HtWLRf. 8TM1ɺPHLP1H5f'XZH!x HL$activate/activate.cGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists./lib/modules%s/%s/modules.builtin%s: %s failed: %skvdodm-%sfcloseInterrupted...misc/lvm-signal.cLogical volume %s in use.metadata/snapshot_manip.cactivate/dev_manager.csnapshotthin-poolChecking device id for LV %s.%*u:%*u %u (no device driver)Counted %d open LVs in VG %s.Found active component LV %s.Found active holder LV %s. [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s temporary noscanmetadata/raid_manip.cSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active.No host tag matches %slocking for suspendunlocking on resumeGetting driver versiondevice_mapper/libdm-common.cFailed to get driver versioncache/lvmcache.c#orphansbase/data-struct/list.chead->ndevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstis not used foris used forhas nohasis notis not inis inlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerdevice not founddevice is a duplicatedevice cannot be used[unknown](root)How LVM uses block devices. allocationshellHost tag settings. validate_metadataabort_on_errorsprofile_dirdevice_id_sysfs_dir/sys/#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfile@DEFAULT_USE_DEVICES_FILE@system.devicesdevicesfile_backup_limitsearch_for_devnamesdevice_ids_refreshdevice_ids_refresh_checks#Sproduct_uuid#Shostname#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_modecache_policycache_settingspolicy_settingscache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogjournaloverwritelevelindentcommand_namesactivate_filedebug_classesdebug_file_fieldsdebug_output_fieldsbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasktestunitssi_unit_consistencysuffixfallback_to_lvm1format_librariessegment_libraries/proc@DEFAULT_PROC_DIR@Location of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_defaultraid1@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activation@DEFAULT_EVENT_ACTIVATION@use_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendsanlock_align_sizelvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_restore_executable/usr/sbin/thin_restore@THIN_RESTORE_CMD@thin_check_optionsthin_repair_options#Sthin_restore_optionsthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_restore_executable/usr/sbin/cache_restore@CACHE_RESTORE_CMD@cache_check_optionscache_repair_optionscache_restore_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeerror_when_fullreadaheadraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallmonitoringpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatacopiesvgmetadatacopiespvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colsalignedbufferedheadingslist_item_separatorprefixesquotedcolumns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagshost_listsystem_idextra_system_idshost_idmodule string allocation failedsnap_seg module string allocation failed%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionModules path %s/%s/modules.builtin is too long.Found %s as built-in kernel module.module_present module name too long: %sInternal error: Target present version called when activation is disabled.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking snapshot percent for LV %s.Internal error: Cannot get origin from snapshot %s.Checking mirror percent for LV %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Unable to send message to an inactive logical volume.Internal error: %s is not a writecache logical volume.Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Checking status for cache volume %s.Checking thin pool status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Preloading detached hidden volume %s as visible volume %s.Cannot determine activation status of %s%s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.Cannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.Activation of logical volume %s is prohibited while logical volume %s is active.activation/volume_list configuration setting not defined: Checking only host tags for %s.Not activating %s since it does not pass activation filter.No degraded or partial activation for raid with integrity.Integrity must be removed before degraded or partial activation of raid.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of RAID LV %s with visible SubLVs.Refusing activation of LV %s containing an unrecognised segment.WARNING: lookup found duplicate VGID %s for VGs %s and %s.Internal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.vgnameid_list allocation failed.vgnameid_list member allocation failed.Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %s.Same wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping info)Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.Internal error: PV %s with duplicates no alternate list entry for %sPV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.PV %s: device_id %s. %s is %s. %s is %s.Checking for multipath components for duplicate PVID %s_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: NULL vgname handed to cacheFailed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Allows to select the level of validation after metadata transformation. Validation takes extra CPU time to verify internal consistency. Accepted values: full Do a full metadata validation before disk write. none Skip any checks (unrecommended, slightly faster). # Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Location of sysfs for finding device ids (for testing.) Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are listed in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. The max number of backup files to keep in /etc/lvm/devices/backup. LVM creates a backup of the devices file each time a new version is created, or each time a modification is detected. When the max number of backups is reached, the oldest are removed to remain at the limit. Set to 0 to disable backups. Only the system devices file is backed up. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Find PVs on new devices and update the device IDs in the devices file. If PVs are restored or moved to a new system with new devices, but an old system.devices remains with old device IDs, then search for the PVIDs on new devices and update the device IDs in system.devices. The original device IDs must also not be found on the new system. See device_ids_refresh_check for conditions that trigger the refresh. Conditions that trigger device_ids_refresh to locate PVIDs on new devices. product_uuid: refresh if /sys/devices/virtual/dmi/id/product_uuid does not match the value saved in system.devices. hostname: refresh if hostname does not match the value saved in system.devices. (hostname is used if product_uuid is not available.) Remove values from this list to prevent lvm from using them. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Allow LVM LVs to be used as PVs. When enabled, LVM commands will scan active LVs to look for other PVs. Caution is required to avoid using PVs that belong to guest images stored on LVs. When enabled, the LVs scanned should be restricted using the devices file or the filter. This option does not enable autoactivation of layered VGs, which requires editing LVM udev rules (see LVM_PVSCAN_ON_LVS.) Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximum is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less then the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Deprecated enablement whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Deprecated option to specify the write policy with these accepted values: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the empty header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. Note that if report/output_format (or --reportformat command line option) is set to json or json_std, then log/report_command_log=1 is default. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. To make all the command log lines visible, use "all" value for the command log selection. For more information about selection criteria in general, see lvmreport(7) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metadata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Disable event based autoactivation commands. WARNING: setting this to zero may cause machine startup to fail. Previously, setting this to zero would enable static autoactivation services (via the lvm2-activation-generator), but the autoactivation services and generator have been removed. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The sanlock lease size in MiB to use on disks with a 4K sector size. Possible values are 1,2,4,8. The default is 8, which supports up to 2000 hosts (and max host_id 2000.) Smaller values support smaller numbers of max hosts (and max host_ids): 250, 500, 1000, 2000 for lease sizes 1,2,4,8. Disks with 512 byte sectors always use 1MiB leases and support 2000 hosts, and are not affected by this setting. The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin pool metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_restore command. LVM uses this command to restore generated data for a thin pool metadata device. Also see thin_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. List of options passed to the thin_restore command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_restore command. LVM uses this command to restore generated data for a cache metadata device. Also see cache_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. List of options passed to the cache_restore command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID. (appmachineid is recommended to avoid exposing the confidential machine-id.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Memory size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronizing or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, raid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over report/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. json_std JSON format that is more compliant with JSON standard. Compared to original "json" format: - it does not use double quotes around numeric values, - it uses 'null' for undefined numeric values, - it prints string list as proper JSON array of strings instead of a single string. Note that if json or json_std output format is used, then log/command_log_report=1 is default. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Format of LVM command's report output headings. Accepted values: 0 no headings, 1 headings with column abbreviations, 2 headings with full column names. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as a decimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The sanlock host_id used by lvmlockd. This must be unique among all the hosts using shared VGs with sanlock. Accepted values are 1-2000, except when sanlock_align_size is configured to 1, 2 or 4, which correspond to max host_id values of 250, 500, or 1000. Applicable only if LVM is compiled with support for lvmlockd+sanlock. dm_list_addunknownsys_wwidsys_serialmpath_uuidmd_uuidloop_filecrypt_uuidlvmlv_uuiddevnamewwid_naawwid_euiwwid_t10nvme_eui64nvme_nguidnvme_uuidחA Setting %scache_segtype/cache.ccommands/toolcontext.cSetting host tag: %swritecache/writecache.cwritecachewritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agepause_writebackwritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %umetadata_only = %upause_writeback = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"integrity/integrity.cdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluallow_discards = %udevice_mapper/libdm-deptree.cNo integrity meta uuid.queue/daxLV %s dev %s is pmem.metadata/metadata.cLV %s dev %s not pmem.LV %s on pmemrealmisc/lvm-string.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitchunk_size = %ucache_mode = "%s"metadata = "%s"metadata_format = %ucache_pool = "%s"cleaner = 1metadata_start = %lumetadata_len = %lumetadata_id = "%s" Chunk size %s Metadata format %u Mode %s Policy %sdevice_mapper/libdm-config.ccache_pool_corigmetadata_startmetadata_lenmetadata_idCache supports %s.SMQMissing cache's data uuid %s.migration_thresholdfilelinemessagelvmcache %s: now in VG %s %slocalhostWARNING: %s: fopen failed: %sLVM_SUPPRESS_SYSLOGmisc/lvm-globals.cLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINES%s%s%s failed: %sLogging initialised at %sLVM_ configuration invalid.host_filterhost_filter not supported yet%s/lvm%s%s.confFailed to create config treeprofile_params alloc failedraid/raid.cthin/thin.cInitialised segtype: %scache-poolvdo/vdo.cvdo-poolInitialised segtypes: %s, %s._init_hostnameunamearchive_init failed.backup_init failed./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETdevice_mapper/mm/pool.c [%p] %s/dev/Ignoring %s: %s.device/dev-cache.cIgnoring %s: Not a directory.dir_list allocation failedReloading config filessequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustmentDuplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedorigin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0Integrity target version older than minimum 1.6.0String list allocation failed for writecache module.String list allocation failed for integrity module.String list allocation failed for cache module.Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeMissing integrity's meta uuid %s.Missing integrity's origin uuid %s.Internal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.Invalid mix of cache device types in %s.Failed to build LVM dlid for %s.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Unknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.Internal error: Incorrect policy_settings tree, %s.Internal error: LV %s is using unknown cache metadata format %u.Couldn't read cache chunk_size in segment %s of logical volume %s.WARNING: Ignoring unsupported value for %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsupported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Internal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %sInternal error: _destroy_config: cmd config tree not destroyed fullylvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %sWARNING: fix duplicate VGID %s for VGs %s and %s (see vgchange -u).Ignoring %s with conflicting VG info %s %s.lvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.Fix duplicate VG names with vgrename uuid, a device filter, or system IDs.lvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sWARNING: Empty system ID supplied.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Failed to allocate system ID.WARNING: Ignoring extra line(s) in system ID file %s.TEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.WARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".Failed to obtain pid and starttime.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".Internal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dUnrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Invalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failed_init_profiles: dm_strncpy failedFailed to allocate memory for %s segtypeFailed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtypeFailed to allocate memory for VDO segtypes.Failed to allocate memory for writecache segtypeFailed to allocate memory for integrity segtype_init_hostname: dm_pool_strdup kernel_vsn failed_init_hostname: dm_pool_strdup failedWARNING: Metadata changes will NOT be backed upReleasing activation in critical section.libdevmapper exiting with %d device(s) still suspended.device_mapper/ioctl/libdm-iface.cYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheInternal error: Unprocessed pending delete for %d devices.raid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%deHImMSuUVwWycCxXyYglobal/cache_disabled_featurescache metadata2 policy_smqcache-smq and aliases cache-mqpolicy_smqcache-smqpolicy_mqcache-mq@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@_get_config_node_version: couldn't create version stringInternal error: Profile %s already added as %s type, but requested type is %s._config_array_line: dm_pool_strdup failedPersistent cache directory name too long.Couldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.struct device allocation failedWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldUsing metadata size 960 KiB for non-standard page size %d.WARNING: async io still in flight.Limit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockDevice seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingFailed to add alias to dev cache.Couldn't add name to hash in dev cache.Failed to allocate configuration check handle.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Failed to open config file %s.Internal error: _cfg_def_make_path: supplied buffer too small for %s/%s%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. _get_def_array_values: strdup failedInternal error: Default array value malformed for "%s", value: "%s", token: "%s".Failed to create default empty array for %s.Failed to duplicate token for default array value of %s.Failed to create default config array value for %s.Internal error: Inconsistent state reached in _check_value_differs_from_default.Failed to create default config setting node.Internal error: _add_def_node: unknown typeFailed to create default config setting node value.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: %s cfg tree element not declared as boolean._log_array_value_used: failed to write node value%s not found in config: defaulting to %sInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: Trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeFailed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Failed to allocate config source.Internal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.%s not found in config: defaulting to %ldWARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.bcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)concurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zero_get_sysfs_value: %s: no valueDevice directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationWARNING: Ignoring unknown validate_metadata setting: %s.DM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryLVM activation checks disabledWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.%sdevices/virtual/dmi/id/product_uuid_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.Found dev %u:%u %s - exists. %.8sCouldn't insert device into binary tree.Found dev %u:%u %s - new alias.Found dev %u:%u %s - new device, path was previously %u:%u.Found dev %u:%u %s - failed to use.Found dev %u:%u %s - existing device, path was previously %u:%u.Skipping "%s" (no block devices).Creating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyconfig/config.cdevice/bcache.cio_destroyWARNING: %s failed: %s.misaligned data bufferio_geteventsunable to allocate sync_iodisk/lstat/dev/nvme%s is not a regular file%s is empty<#option%s# Configuration %s %s. %s# %s%s#%s%s - %s%s%s%s%s%s%s # %.*s%s%s section integer float stringSetting %s to %sUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cachedatastruct/str_list.cstr_list allocation failedfgetsSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s.LVM activation checks enabled/dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idproduct_uuid%s: Not available device node%sdev/block/%u:%u/holders/opendir%sblock/%s/devclosedirFound dev %u:%u %s - new.Dir path %s is too longPath %s/%s is too long.Drop alias for %u:%u %s.Failed to udev_enumerate_new.j3 ܸbsg/bus/char/cpu/dma_heap/dri/input/snd/usb/dm_list_add_hundefinedfilemerged filesstringcommand profilemetadata profilespecial purposeD,!@T"4Device '%s' has been left open (%d remaining references).%sdev/block/%d:%d/device/blockFound %s for %d:%d from sys dm.Failed to create sysfs path for %sWARNING: cannot open devices file to read.check devices file version %s prev %sMismatching UUID or devno found %s %u:%u %s %u:%u.Creating DM cache for devno and uuid.Internal error: %d device(s) were left open and have been closed.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Preferred device name pattern matcher creation failed.Failed to allocate a preferred device name pattern.Couldn't create binary tree for sysfs-only devices in dev cache.Couldn't create binary tree for dev-cache.Drop alias for %u:%u invalid path %s %u:%u.Ignoring dev with no valid paths for %s.Device path %s is invalid for %u:%u %s.Dropping aliases for device entry %u:%u %s for new device %u:%u %s.Dropping aliases for %u:%u before adding new path %s.dev_cache_get filter excludes %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathCannot access device %s for %u:%u.No device name found from %u:%u.Cannot access device %s from %u:%u.Found %s devno %u:%u expected %u:%u.Device lookup failed for %u:%u %s%s: failed to insert device list to device cache index.%s: failed to allocate device list for device cache index.device_id_system_read reduced underscores %s to %sMatch dm names %s %s for %u:%u (from cache).Match dm names %s %s for %u:%u (from stat)Match %s %s to %s: using extra %s %sdevice_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Failed to allocate buffer size %d for devices file.Failed to write buffer for devices file content.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s # LVM uses devices listed in this file. # Created by LVM command %s%s pid %d at %s# HASH=%u Failed to write devices file header.Failed to replace devices file.Wrote devices file %s hash %u hashed size %u total size %u%s/devices/backup/system.devices-%s.%04uWARNING: Failed to create backup file %sWARNING: Failed to write backup file %sWARNING: Failed to sync backup file %sWARNING: Failed to sort backup devices files.Limit backup %u found %u sorted %d removing %u.WARNING: devices to use does not include %sdevice_id update %s pvid %s vgid %s to %sCannot create devices file, missing devices directory %s.WARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dSkip devices file update (busy).Skip devices file update (changed).Validating devices file entriesValidating %s %s PVID %s: initial match %sValidate %s %s PVID %s on %s: replace old wwid with %sDevice %s PVID %s is using only old wwid %s.Validate %s %s PVID %s on %s: not scannedValidate %s %s PVID %s on %s: not readValidate %s %s PVID %s on %s: filtered (%s)suspect device id serial %s for %sValidate %s %s PVID %s on %s: wrong PVID %sDevice %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Validate %s %s PVID %s on %s: correctValidate %s %s PVID %s on %s: outdated DEVNAME %sWARNING: fixing devices file IDNAME %s for PVID %s device %sValidate %s %s PVID %s: found on %sValidate %s %s PVID %s: no device foundValidate %s %s PVID %s: no device found, remove incorrect PVIDValidate %s %s PVID none: remove entry with repeated devnameValidate %s %s PVID %s: no idname, set invalid.Validate %s %s PVID %s: no device for idtype devname, set invalid.Validated device ids: invalid=%d, update disabled.Validated device ids: invalid=%d, trying to update devices file.Validated device ids: hash mismatch, update disabled.Validated device ids: hash mismatch, trying to update devices file.Validated device ids: invalid=%d, no update needed.Override device_ids_invalid for complete hints.Validate %s %s PVID %s on %s: wrong PVID %s.Finding all devs with suspect serial numbers.Reading and filtering %d devs with suspect serial numbers.Checking %d PVs with suspect serial numbers.Matching suspect serial device id %s PVID %s prev %sMatch suspect serial device id %s PVID %s to %sMatch PVID failed in %d devs checked.Matching suspect serial device id %s unmatched PVID %s prev %sNo device matches devices file PVID %s with duplicate serial number %s previously %s.Device %s with serial number %s has PVID %s (devices file %s)Drop incorrectly matched serial %sDevices file %s %s PVID %s not found.Search for PVIDs %d trigger %d all_ids %d search all %d auto %d none %dSearch for PVIDs skipped for matching %sSearch for PVIDs reading labels.Search for PVIDs skip %s (stable id)WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Search for PVID %s found on %s.Devices file PVID %s has new device ID %s %s from %s.Found new device name %s for PVID %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatessearched_devnames_create error fopen %dsearched_devnames_create error open dir %d# Created by LVM command %s pid %d system.devices %s at %ssearched_devnames_create error fflush %d fclose %dsearched_devnames_create error rename %dsearched_devnames created pvids %d %u devs %d %uCannot open devices file to read.Devices file invalid hash value errno %dDevices file hostname %s vs local %s.read devices file product_uuid %sDevices file product_uuid %s vs local %s.WARNING: failed to process devices file entry.Devices file comment hash %u calc hash %uDevices file refresh: missing product_uuidDevices file refresh: missing product_uuid and hostnameDevices file not found, ignoring.Failed to lock the devices file to read.Failed to read the devices file.Matching devices file entries to devicesMatch %s %s PVID %s: done previously %sMatch %s %s PVID %s: done %s (immediate)Match %s %s PVID %s: wrong devname %sMatch %s %s PVID %s: no device matchesMatch %s %s PVID %s: no idnameMatch %s %s PVID %s: idname not foundMatch %s %s PVID %s: dev %s already matched to an entryDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Failed to lock the devices file to create.Failed to lock the devices file.system.devices-/dev/%sFound %s for %d:%d from sys%sdev/block/%d:%d/dm/name%u %u %llu %128sFound %s for %d:%d from %s%sdev/block/%u:%u/%sdevice/device_id.cVERSIONDestroying DM devno cache.Destroying DM uuid cache.Preserving DM cache.not found in configdev_cachepreferred device name matcherstrdup dev_dir failed.Not a block device %s.Failed to get device %smetadata_versionDevice %s %s is %s.device/dev-md.c1.00.90%s/devices/dmeventd.devices%s/devices/%s%Y%m%d.%H%M%S%s/devices/%s-unused.%sDevices file moved to %s%s/devicesCreating %s.Failed to create %s %dInvalid device type %s.parteui.naa.t10.device/vpd_pg83t10.%seui.%snaa.%sdevice/serialdevice/vpd_pg80/dev/vd%s/class/block/%s/serialmd/uuidloop/backing_file(deleted)__QEMUmpath-CRYPT-LVM-/dev/dm-/dev/mapper/Match %s %s to %s (auto)pvcreatevgcreateCreating devices file %s%s_newunlinkw+Cannot open to write %s.PRODUCT_UUID=%s HOSTNAME=%s VERSION=%u.%u.%uFailed to write devices file.%s/devices/backup/Wrote backup %sdirfdRemove backup %sunlinkatDevice not found for %s.%s/D_%sDevices file update skipped.not setpersistentDrop incorrectly matched %susablempathserial missing for %sserial %s pvid %s %sserial %s nolabel %sserial %s no pvid %sfwraidserial %s pvid %s filtered %sSearch for PVID %s.Search for PVIDs filtering.Search for PVIDs on %slvmdeviceswxpvids: %d %u devs: %d %u device_ids_read already donedevice_ids_read %s# HASH=0# HASHSYSTEMIDHOSTNAMEread devices file hostname %sPRODUCT_UUIDread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTCannot access device %s.Match %s %s PVID %s: done %sDevices file not found: %sDEGpD0GpGpDpDIXFXFXFDFFFrrrrrr  /run/lvm/run/lvm/searched_devnames_new/run/lvm/searched_devnames/proc/partitionsdevice/dev-ext.cdevice/dev-io.cClosed %sdevice/dev-luks.cLUKSblacklist_exceptionsblacklistdevice/dev-mpath.cmultipath wwid %s in %s %snot %sdev/block/%u:%ureadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dirdevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.device/nvme.cNOT display/display.cPV Name %s PV UUID %sTotal PE / Free PE %u / %u (test mode - suppressed)%s: size is %lu sectorsIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND/etc/multipath.confloopdevice-mapperblkextdrbddasdemcpowerVxDMPpower2%sdev/block/%u:%u/partitionsysfs file %s does not exist.%s/dev/block/%u:%u/md/%sdm_snprintf md %s failed%s/block/md%u/md/%sdm_snprintf old md %s failedmpath_memberDM_MULTIPATH_DEVICE_PATHunusedFailed libblkid probe for %sNo file system found on %s.No file system type on %s.BLOCK_SIZEFSLASTBLOCKFSBLOCKSIZEFSSIZEswapLVM2_memberLVM1_memberSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELDM_snapshot_cowsoftware RAID md superblockswap signatureLUKS signaturedevice/dev-dasd.cioctl BIODASDINFO2%sdev/block/%u:%u/holdersdevice/filesystem.cMissing %s for %s.Cannot open %s.Unrecognized holder %s of %sFound holder %s of %s.No holder in %sWARNING: Failed to open %s.device/online.cWARNING: No info in %s.vg:No vgname in %sdev:No devname in %s/run/lvm/pvs_onlineFound PVs online %d for %s/run/lvm/vgs_onlineUnlink vg online: %sCreate vg online: %sFailed to create %s: %d%u:%u vg:%s dev:%s Check pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/pvs_lookupUnlink pvs_lookup: %snext freeclvmFailed to get LV path %s/etc/mtab%s mtab mntpath %s/proc/mounts%4096s %4096s %4096sLVRESIZE_FS_HELPER_PATH--fsreduce--fstype--lvpath--newsizebytes--mountdir--unmount--mount--fsck/dev/dm-%u--cryptresize--cryptpathmanage--remountReduced file system %s on %s.--fsextend%.2fPercentage %d does not fit.SCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic MultipathingUdev database has incomplete information about device %s.Found md ddf magic at %llu wrong crc %x disk %x %sSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %u:%u.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentFatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: dev_read_nvme_wwids ignore invalid nguid %s for %sdev_read_nvme_wwids ignore invalid eui64 %s for %sPV Status %sallocatableWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %d%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detachedAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedDiscarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sFound md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.multipath config ignored %d wwidsFailed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sWARNING: %s: partition path is too long.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sdev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileFailed libblkid probe setup for %sFound blkid fstype %s fsblocksize %s on %slibblkid TYPE %s BLOCK_SIZE %d FSLASTBLOCK %llu FSBLOCKSIZE %u fs_last_byte %lluFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.WARNING: sysfs file %s not in expected format: %sCouldn't create holder path for %s.WARNING: No device numbers in %s.WARNING: Ignoring invalid vg field in %s.WARNING: Ignoring invalid vgname in %s (%s).WARNING: Ignoring invalid devname field in %s.WARNING: Ignoring invalid devname in %s (%s).Found PV online %s for VG %s %spvscan[%d] Path %s/%s is too long.Cannot create online file path for %s %u:%u.pvscan[%d] Cannot create online file path for %s %u:%u.Incomplete online file for %s %d:%d vg %s.Incomplete devname in online file for %s.Create pv online: %s %u:%u %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s %d:%d is duplicate for PVID %s on %d:%d %s.pvscan[%d] PV %s %d:%d is duplicate for PVID %s on %d:%d %s.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.Internal error: Path %s/%s is too long.Incorrect VG lookup file %s PVID %s %s.Found PV online lookup %s for VG %s on %s.Found PVs online lookup %d for %s.dev_read_nvme_wwids cannot open %sdev_read_nvme_wwids nvme_get_nsid error %d %sdev_read_nvme_wwids nvme_identify_ns error %d %sdev_read_nvme_wwids nvme_identify_ns_descs error %d %sdev_read_nvme_wwids ignore invalid uuid %s for %sUnrecognised allocation policy %sFull LV name "%s/%s" is too long.LV %s mounted at %s also mounted at %s.LV %s mounted at %s may have been renamed (from %s).File system resizing not supported: fs utilities do not support renamed devices./usr/libexec/lvresize_fs_helperReducing file system %s to %s (%llu bytes) on %s...Failed to reduce file system with lvresize_fs_helper.Extending file system %s to %s (%llu bytes) on %s...Failed to extend file system with lvresize_fs_helper.Extended file system %s on %s.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)Ceph rados object as a Linux block deviceSUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)contiguouscclinglcling_by_tagstnormalnanywhereainheritiWiping %s signature on %s./etc/multipath/conf.d%s: Skipping: Unrecognised LVM device type %luInternal error: Destroying regex filter while in use %u times.read/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sChecking thin status for LV %s.WARNING: LV %s maps %s while the size is only %s.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized compression state: %u.LV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversiondtree node segment allocation failederror module string list allocation failedInternal error: Destroying composite filter while in use %u times.Internal error: Destroying sysfs filter while in use %u times.Internal error: Destroying md filter while in use %u times.Internal error: Destroying firmware RAID filter while in use %u times.Internal error: Destroying mpath filter while in use %u times.Internal error: Destroying partitioned filter while in use %u times.Internal error: Destroying lvm_type filter while in use %u times.Internal error: Destroying usable device filter while in use %u times.Internal error: Destroying signature filter while in use %u times.Internal error: Destroying deviceid filter while in use %u times.%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].Internal error: Destroying persistent filter while in use %u times.%u:%u: filter cache skipping (no name).%s: filter cache skipping (cached bad).%s: filter cache using (cached good).Ignore invalid filter result %d %s.Failed to hash alias to filter.Internal error: PV name for %s missing in metadata export radix tree.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detection%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]%s: Skipping mpath component deviceWARNING: devices file is missing %s (%u:%u) using multipath component %s.See lvmdevices --update for devices file update.%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]%s: Skipping: dev_get_size failed%s: Skipping: error in signature detectionDoubling metadata output buffer to %uRandom lvid creation failed for %s/%s.WARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filter-sysfs disabled: /sys/dev/block not foundCouldn't scan the archive directory (%s).Couldn't create new archive file.Created path %s/%s is too long.Couldn't create text instance object.Internal error: Passed file path name %s is too long.Couldn't copy archive directory name.Couldn't copy backup directory name.Couldn't create text format object.Consider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Failed to allocate format instance.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to duplicate empty name.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"pv device name size is out of bounds.Internal error: problem tracking indentationCould not allocate memory for ancestor list buffer.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more then %u MiB in %u files (see archiving settings in lvm.conf).Test mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.filters/filter-type.c%s: Skipping (deviceid)filters/filter-deviceid.cfilters/filter-regex.cread/writeread onlyINACTIVErecoveringnormaloffline (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%metadata/vdo_manip.cLV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %derroerror/errseg.cfilters/filter-composite.cfilters/filter-sysfs.cfilters/filter-md.cfilters/filter-fwraid.cfilters/filter-mpath.cfilters/filter-partitioned.cfilters/filter-usable.cfilters/filter-signature.cimporting unknown segmentunknown/unknown.cstart_extentextent_countfilters/filter-persistent.cgoodbadfilter caching %s %s.format_text/export.c%s: New preferred name%s: Skipping (regex)failed to create sysfs path%s: Skipping (sysfs)*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.ID_PART_TABLE_TYPEDEVTYPE%s: Skipping unusable device.%s: Skipping: %s%s: Skipping lvm1 device%s: Skipping gfs-pool deviceBuffer reallocation failed.format_text/format-text.cWARNING: No cache info for %sMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaWARNING: Invalid input '%s'.[n] Accepted input: [%c]filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.%sdev/blockformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.# %g %s2.03.28(2)-RHEL9 (2024-11-04)version = %ddescription = "%s"creation_time = %lu # %sstatus = [%s]flags = [%s]seqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"lock_args = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {pv%d {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %lu%s {creation_timecreation_host = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %u+%sstart_extent = %uextent_count = %ureshape_count = %utype = "%s%s"segment%u {historical_logical_volumes {%s"%s"removal_timeorigin = "%s%s"descendants = [%s]uname failed: %s%s/%s_%05u-%d.vgArchive file name too long.%s: rename to %s failed: %smisc/lvm-file.c%s: rename to %s failedExpiring archive %sArchive rename failed for %s%ss = ["pv%d", %u%s"%s", %u%s"%s", "%s"%sStatus value is not a string.format_text/flags.cCACHE_VOLUnknown status flag '%s'.PARTIALALLOCATABLEEXPORTEDMISSINGRESIZEABLEPVMOVEREADWRITEWRITE_LOCKEDNOAUTOACTIVATECLUSTEREDSHAREDFIXED_MINORVISIBLENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLKilobytesMegabytesGigabytesTerabytesPetabytesExabytesToo small to hold a PVnoyes?@P?(ignored)(used)empty prefdopenWriting %s metadata to %sfsyncRenaming %s to %sUnlinking %smda_context allocation failedTest mode: Skipping renameformat_text/text_label.cDevice %s %s is %lu bytes.raid%draid_disksDevice %s %s is %d.queue/minimum_io_sizequeue/optimal_io_sizealignment_offsetPV %s missing from cachepe_startMDA1 startba_startdisk sizelabel scan sizeMDA0 endpe_endba_endformat_instance%s.tmpcontentsmissing contents fieldformat_text/import_vsn1.cText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find section '%s'.Could not find status flags.Could not read status flags.Could not read flags.descriptionEmpty pv section.dev_sizedevice_id_typecreation_hostlock_typeseqnophysical_volumesCouldn't read pv summariesdescendantsmetadata/lv_manip.cba_sizeImporting logical volume %s.allocation_policyread_aheadEmpty logical volume section.Empty segment section.reshape_countstripedSegment allocation failed_mimagetmpsegment_countmajormax_lvmax_pvmetadata_copieshistorical_logical_volumesmirrormetadata/mirror.cread_vgs, mda2 ( mda1 ( da1 ( ba1 (Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Failed to allocate dir_listlabel/label.ctext_orphanInitialised format: %sformat_text/import.cFailed to read VG %s from %sRead volume group %s from %sWrite from %s.Write[%u] from %s.VG %s metadata writing failedclose and reopen excl %sFailed to open device %sVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.Failed to write metadata area headerstruct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Test mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.Creating metadata area on %s at sector %lu size %lu sectorsstruct data_area_list allocation failedPV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedPV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %lluRequested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.Adjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to minimum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.PV %s is a different format (seqno %s)PV %s too large for extent size %s.Internal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: Metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %lluNot enough space available for metadata area with index %u on PV %s.struct mda_context allocation failedstruct metadata_area allocation failedInternal error: can't remove metadata area with index %u from PV %s. Metadata layout not supported by %s format.Failed to move metadata area with index 1 while resizing PV %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.Couldn't allocate text_fid_context.Couldn't allocate format_instance object.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device_id_type in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device hint in read_pv_sum.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Couldn't find volume group in file.Couldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Failed to allocate generic logical volume structure.Failed to allocate list item for historical logical volume %s/%s%sUnknown historical logical volume %s/%s%sFound an item that is not a stringCouldn't read status flags for physical volume.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Failed to allocate memory for device_id_type in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device hint in read_pv.Empty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read segtype %s for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.WARNING: Unrecognised flag(s) %s.Unrecognised format %s for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't create lv_names radix tree.Couldn't create pv_names radix tree.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sInternal error: %s label header currently requires a data area.Found pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: scanning %s mda1 failed to read metadata summary.WARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.Failed to allocate text format type structure.Couldn't allocate labeller object.Couldn't create text label handler.Couldn't allocate memory for labeller list object.Couldn't register text label handler.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.'%s' does not contain volume group '%s'.There are %d physical volumes missing.text_export buffer allocation failedError parsing metadata for VG %s.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sScanning for labels to wipe from %sFailed to read label from %s sector %lluFailed to remove label from %s at sector %llu%s: Wiping label at sector %llu#orphans_lvm2printDM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=687CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %s#globallabel allocation failedrwrwexCannot extend bcache fd tableFailed to set bcache fd.open %s %s di %d fd %dio_setup failed %dFailed to set up sync io.dev_read bcache not set up %sclose and reopen to write %sFailed to write label to %ssome blocks are still lockedlabel/hints.cnewhints createdtouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %sunlock_hints no existing fdunlock_hints flock errno %dlock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %sFinding devices to scanFailed to set up devices.Failed to get device list.get_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entriesValidating hintsInvalid hints: none used.No size for %s./dev/mdclear_hint_file%s/P_%slocking/file_locking.c%s/V_%sUnrecognised lock type: %dmisc/lvm-flock.cLocking %s %c%c convertLocking %s %c%c:auxmemlock reset.mm/memlock.cglobal flock already held exlocking/locking.cstderrstdoutstdindup2dup2(%d, %d) returned %dread%d Cannot parse content of %s.metadata/cache_manip.cmetadata/lv.cfailed to write log file: %s failed to write log file Unknown cache mode: %s.another LVCan't convert internal LV %s.%s_cpoolsmqreporter_poolmetadata/writecache_manip.cFailed to deactivate %s.flush_on_suspendRemoving previous wcorig %smetadata/integrity_manip.cbitmapunassigned:%u-%u(%u)not enablednot monitored%s is %son %stpoolvpoollvpath snprintf faileddm_pool_alloc failedActivating logical volume %s.Thin volume %s is active.Flushing of %s aborted.vsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).Device open %s has DEV_IN_BCACHE already setDevice open %u:%u has no path names.Device open %s already open with di %d fd %dCan't open %s exclusively. Mounted filesystem?Drop alias for %u:%u failed open %s (%d).Invalid path %s for device %u:%u, trying different path._SC_PAGESIZE returns negative value.couldn't create control block setFailed to set up async io, using sync io.WARNING: _SC_PAGESIZE returns negative value.bcache block size must be a multiple of page sizeFailed to set up io layer with %d blocks.Error opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.Error writing device value %s at %llu length %u.dev_set_bytes bcache not set up %s# Created empty by %s pid %d %sEnable full md component check.Filtering devices to scan (nodata)Filtering devices to scan done (nodata)Clear pvid and info for filtered dev %s.get_hints: applied using %d other %d vgname %sWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Will scan %d remaining devicesextra md component check skip %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)extra md component check %llu %llu device_hint %s dev %sInvalid hint device %d:%d %s pvid %s had vgname %s no PV info.Too long locking filename %s/P_%s.Too long locking filename %s/V_%s.Failed to convert flock on %s %dInternal error: Unknown locking mode %s.Internal error: reopen_standard_stream called on non-standard stream %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluCannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.WARNING: Ignoring unrecognized journal value.Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cannot set cache mode for non cache volume %s.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Can't prepare new cachepool name for %s.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Replacing chunk size %s in cache pool %s with chunk size %s from profile.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Detected default cache metadata format: %u.Internal error: Failed to wipe cache pool for volume %s.Skipping wipe of %s volume with %s segtype.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to activate LV %s for flushing writecache.Failed to flush writecache for %s.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to deactivate LV %s for detaching writecache.Failed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.integrity_meta_bytes %llu from lv_size_bytes %llu meta_bytes %llu initial_bytes %llu journal_sectors %uLV %s segment is unsupported raid for integrity.LV %s segment has no integrity metadata device.LV %s integrity segment has no originFailed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")_format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvsegs: extent range dm_snprintf failed._format_pvsegs: extent number dm_snprintf failed._format_pvsegs: list item dm_snprintf failed_format_pvsegs: failed to add item to list_format_pvsegs: list item dm_pool_zalloc failedWARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.Internal error: Bad pvmove structureInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentCannot remove from lv_names LV %sDuplicate LV name %s detected.Cannot insert to lv_names LV %sFailed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.WARNING: Skipping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Internal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.LV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s. PH unknownnonepublicprivatehistorylinearstripedmirrorraidthincachesparseoriginthinoriginmultithinoriginthickoriginmultithickorigincacheoriginextthinoriginmultiextthinoriginsnapshotthinsnapshotthicksnapshotpvmoveimagelogmetadatapooldatasparevdovirtualraid0raid0_metaraid1raid10raid4raid5raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_nclockdsanlockcachevolwritecachewritecacheoriginintegrityintegrityoriginpre-cmdcmdorphanpvlabelvglvshellprocessing_vprint_logfatalerrorwarnnoticeinfodebug/proc/self/stat/run/lvm/hints/run/lvm/nohints/run/lvm/newhints %s/%s uses %sFailed to allocate memory with PV tags: Changing Consideringhistorical Failed to create new nameCannot rename locked LV %s and openlv_info failed: aborting.--dry-run--verbose--yes--forcemetadata areaCan't resize reshaping LV %s.Skip unmount in test mode.Skip fsck in test mode.Skip mount in test mode.Skip cryptsetup in test mode.Skip fs extend in test mode.Stack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata/pv_manip.cqueue/discard_max_bytesqueue/discard_granularityNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %sup to contiguous metadata/pv_map.cpvl->pv->devdm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areascreate_pv_maps alloc failed_cdata_tdatarimagemetadata/pool_manip.c%s_%s%s_%s_%u%s_rmeta_%uFailed to insert layer for %sReducingExtending%s logical volume %s to %s%sHistorical physicallogicalat most resize2fs+crypto_LUKSequal tosmaller thanlarger than cryptsetup, mount, fsck, unmount, xfs_growfsNo size change.locking/lvmlockd.cgfs2ocfs2%s/%s/%sFailed to activate %s.checksizeresize_fsadmFilesystem check failed.Filesystem resize failed.ext2ext3ext4xfsFile system %s%s found on %s.reiserfsnochangeFile system not reduced.Skip fs reduce in test mode.Problem deactivating %s.%s: discarding failed.Found fs %s last_byte %lluFile system not extended.Resized %s to %u extents.metadata/thin_manip.cFile system extend error.Memory reallocation for parallel areas failed.PV tags string allocation failed.PV tags string extension failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.LV %s using PV %s is not redundant.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Cannot use misconfigured fsadm executable to resize %s.Couldn't create LV path for %s.Couldn't generate new LV size string.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Cannot resize a RAID %s directly for %sCannot resize %s LV %s. Convert to more stripes first.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.RAID module does not support shrinking.Cannot reduce LV with integrity.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Ignoring PVs on command line when reducing.Internal error: LV is not specified.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Cannot resize logical volume %s with active component LV(s).Cannot resize logical volume %s while it is tracking a split image.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s.Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: No single component user of logical volume %s.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Failed to remove temporary SubLVs from %sInternal error: Cannot remove undefined LV.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uRemove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Couldn't create physical volume maps in %sParallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.allocated_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.allocation handle allocation failedInternal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Generating list of PVs that %s/%s uses:Adding segment of type %s to LV %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.%s: Required device-mapper target(s) not detected in your kernel.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Failed to deactivate pool volume %s.Manual intervention may be required to remove abandoned LV(s) before retrying.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.Size of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.lvresize_extents_from_percent type %d extents %u percent_value %uReducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Can't resize internal logical volume %s.--poolmetadatasize can be used only with thin pools.Extending thin pool metadata to %llu for larger dataLV in VG %s with lock_type %s requires lvmlockd.LV path too long for lvmlockd refresh.Cannot activate to resize %s without using device-mapper kernel driver.Ignoring fs resizing options for LV type %s.The LV must be active to safely reduce (see --fs options.)Failed to activate %s to check for fs.Logical volume %s must be active for file system %s.File system not found for --resizefs or --fs options.LUKS dm-crypt device must be active for fs resize.File system size %llub is adjusted for crypt data offset %ub.Found fs %s last_byte %llu newsize_bytes_fs %lluFile system %s%s found on %s mounted at %s.File system reduce for reiserfs requires --fs resize_fsadm.File system device usage is not available from libblkid.File system size (%s) is %s the requested size (%s).File system reduce is not needed, skipping.File system reduce is required (see resize2fs or --resizefs.)File system reduce is required and not supported (%s).File system reduce is required using resize2fs.File system needs to be mounted to reduce fs (see --fsmode).File system needs to be unmounted to reduce fs (see --fsmode).Unknown file system resize options: --fs %s --fsmode %sFile system unmount is needed for reduce.File system fsck will be run before reduce.File system mount is needed for reduce.cryptsetup resize is needed for reduce.Continue with %s file system reduce steps:%s%s%s%s%s? [y/n]:crypt device is already reduced to %llu bytes.crypt reduce is required (see --resizefs or cryptsetup resize.)Failed to resize crypt dev with lvresize_fs_helper.Failed to lock VG, cannot reduce LV.VG was changed during fs operations, restarting.File system last byte %llu is greater than new size %llu bytes.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Resized thin pool metadata %s to %u extents.File system extend for reiserfs requires --fs resize_fsadm.File system extend is not supported (%s).File system must be mounted to extend (see --fsmode).File system type %s not handled.File system fsck skipped for extending mounted fs.File system unmount is needed for extend.File system fsck will be run before extend.File system mount is needed for extend.cryptsetup resize is needed for extend.Continue with %s file system extend steps:%s%s%s%s%s? [y/n]:Internal error: Updated LV %s is not thin pool.uuDvvname allocation failed for '%s'pv_list allocation for '%s' failedVolume group %s does not support tagsFailed to add tag %s to volume group %sFailed to duplicate tag %s from %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sAdjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sCalculated readahead of LV %s is %uInternal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Internal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s shouldn't have lock_args %s.Internal error: LV %s with no lock_type has lock_args %s.Internal error: LV %s/%s appearing in VG's historical list is not a historical LV.Internal error: Historical LV %s points to different VG %s while it is listed in VG %s.Internal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sFailed to store historical LV name.Internal error: Duplicate historical LV name %s detected in %s.Failed to store historical LV id.Internal error: Duplicate historical LV id %s detected for %s in %s.Internal error: Name %s appears as live and historical LV at the same time in VG %s.Internal error: Historical LV %s is not part of any LV chain in VG %s.Failed to allocate lv_lock_args hashFailed to allocate lv_name hashUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentSegment with extent %u in LV %s not found89L9\88Allowing forced access to clustered vg %sInvalid index (%u) of mirror image supplied to shift_mirror_images().Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Volume group %s is not resizeable.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Internal error: LV %s (UUID %s) not found in committed metadata.Cannot allocate lock for new LV.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Validating volume group structure.Skipping validation of volume group structure.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!Internal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_get_outdated_mdas no vginfoWARNING: wiping mda on outdated PV %sFailed to read outdated pv mda header on %sFailed to write outdated pv mda header on %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Intermediate VG commit for orphan volume failed.Internal error: lvmcache_get_mdas no vginfo %sRescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.bcache_invalidate: block (%d, %llu) still heldRescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan skipped - unchanged offset %llu checksum %x.Failed to read existing physical volume '%s'No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sWARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Failed to allocate pv structure.Volume group name "%s" has invalid characters.Can't allocate DM cache memory for VG %s.WARNING: activating multiple VGs with the same name is dangerous and may fail.Cannot reopen rw device %u:%u with no valid paths di %d fd %d.Cannot reopen rw device %u:%u with no valid name di %d fd %d.Failed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Internal error: Cannot change not opened DI with FD:%dreopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dIgnoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.Internal error: lvmcache_update_vg %s no vginfoWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.See vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %slvmcache_update_vg %s for info %slvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %svg_read %s ignore mda for outdated dev %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.Failed to destroy record about historical LV %s/%s.WARNING: failed to strip outdated historical lvs.Outdated record for historical logical volume "%s" automatically destroyed.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pCannot change VG %s with unknown segments in it!Reopen writeable %s uncached fd %d di %dFailed to change to rw fd %s di %d fd %d.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Unable to determine mirror sync status of %s.Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelUnable to allocate mirror extents for %s.Failed to split segment at %s extent %u.Failed to add mirror areas to %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Internal error: Unknown mirror flag.Failed to find segment for %s extent %u.Failed to build new mirror log name for %s.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Unable to allocate extents for mirror(s).Reducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Cannot detach mirror log from %s..Failed to initialize log device %s.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.Unable to allocate extents for mirror log.Skipping clustered VG %s._mimage_%d%s_mimage_%%dSettingClearingWARNING: Duplicate id found!Writing metadata for VG %s.WARNING: mda without device.Failed to write VG %s.Aborting. Unable to tag.%s=%s%s=%llu#orphans_lvm2PV %s size is zero.pv allocation failedmissingnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning DM cache.Volume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkRescanning devices for %s %sReading VG %s %sLV %s assigned to be split.lv_list alloc failed.Unable to allocate memory._mimage_0_mlogtmp_%dFailed to create mirror log.Failed to form mirrored log. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s.coreFailed to convert mirror logmetadata/pv_list.cAllocation of list failed.rmeta%s_%s_%%dNot a mirror segment.Discarding message for LV %s.%s_pmsparemetadata/pv.cSkipping invalid tag %s.Failed to clone PV name.pv_segment allocation failed%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uto_go <= pva->countMemory allocation failed.%s_%s%sFailed to allocate new name.raid0_metaFailed to get device count.Failed to get device health.%s called on non-raid1 LV._rimage_0Adding %s to %s.Failed to add %s to %s._rimage_metadata/segtype.cLogical volume %s is already of requested type %s.Adding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Removing more than existing: %d <= %d.Persistent log is not supported on segment-by-segment mirroring.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxInternal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Failed to create historical LV representation for removed logical volume %s.Initialization of historical LV representation for removed logical volume %s failed.%s is referenced by more then one segments (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.Adding new pool metadata spare %u extents.Extending pool metadata spare from %u to %u extents.Internal error: PV %s unexpectedly not in cache.No specified PVs have space available.Failed to create PV entry for missing device.Physical Volume "%s" not found in Volume Group "%s".Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.Internal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uAllowing allocation on %s start PE %u length %uCannot restripe LV %s from %u to %u stripes during conversion.Adjusting region_size from %s to %s for %s.Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Adjusting region size of %s LV from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Failed to prevent PVs holding image components from LV %s being used for allocation.Internal error: LVs must be set visible before removing.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisible by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Checking raid device count for LV %s/%sNo proper new segment length for %s!Failed to build list of PVs for %s.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Extracting image components %s and %s from %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Logical volume %s NOT converted to "%s".Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Failed to clear REBUILD flag for %s components.Allocation of new meta areas failed.Allocation of new areas failed.%s is out-of-sync! Please try refreshing first.Minimum 3 stripes required for %s LV %s.Internal error: No change of image count on LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Failed to adjust LV %s to new size!Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: Unrecognised segment type flag 0x%016lxInternal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Internal error: Invalid data lvs for raid0 LV %s.Failed to allocate new raid0 segment for LV %s.Cannot convert striped LV %s with varying stripe count to raid0.Converting the segment type for %s from %s to %s is not supported yet.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s._raid_reshape_remove_imagesconsume_pv_area--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%2u--uds-sparseCommand %s failed.Removing mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.Rea--stripes-I/--stripesize-R/--regionsizeLV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Failed to allocate name.Adjust data LVs of %s._mimage_Data LV renamed to %s.raid with integritylocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesFailed to resume %s.Added %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupperformanceCropping metadata size to %s.nopassdownSetting chunk size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.internalwritableclosedopeningclosingstatistics/data_blocks_usedSkipping VDO formatting %s._vdata%s_vpool%%dasyncasync-unsafeUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree%s/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s.Allocated VG %s at %p.Failed to allocate VG name.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Failed to build device path for VDO formatting of data volume %s.Slab size %s converted to %u bits.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Unable to convert %s while it is not in-sync.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Failed to allocate meta areas memory.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.%s must be active to perform this operation.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %s%s%s%s? [y/n]: Can't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Unable to convert %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Failed to allocate memory for unknown segtypeWARNING: Unrecognised segment type %sAre you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Snapshot volume cannot be smaller than 3 chunks (%u extents, %s).an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.Internal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsistent external origin.Internal error: LV %s is not a thin pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: thin_pool_is_active called with non thin pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.Size of %s data volume cannot be smaller than chunk size %s.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).Preferred pool metadata size %s.Cannot use %s volume %s as external origin.Cannot use active LV for the external origin., perhaps skipped in lvm.conf volume_list?Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Internal error: Unrecognized index state: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedRounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formatting of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formatted VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Can't prepare vdo pool name for %s.Can't generate new name for %s.Aborting. Failed to wipe VDO data store %s.Deprecated VDO setting write_policy specified.Deprecated VDO setting use_metadata_hints specified.Sysinfo free:%llu bufferram:%llu sharedram:%llu freehigh:%llu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.Failed to allocate volume group structure @P0 and,,      _raid_reshape@CNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Couldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Couldn't read 'mirror_count' for segment '%s'.Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).dm_report_field_string: dm_pool_strdup failedInternal error: Using string as sort value for numerical field.Target raid does not support %s.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!mirror string list allocation failedraid module string list allocation failedWARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sCouldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Bad volume name in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Missing data device in areas array for segment %s.Incorrect number of areas in area array for segment '%s'.Failed to import RAID component pairs.Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.alloc_time_item: dm_pool_zalloc failedFailed to create cache for values used during reporting._get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failed_get_now: dm_pool_zalloc failedFailed to get value for parsed time specification.Failed to allocate space to store time range.modules str_list allocation failedFailed to create list of writecache settings.Internal error: global memory pool used for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Internal error: Unable to find configuration for %s options.Too many options for %s command.Invalid string in config file: global/%s_options.Names including "%s" are reserved. Please choose a different LV name.Names starting "%s" are reserved. Please choose a different LV name.Missing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't find mirror log uuid %s.Internal error: Name is too long.Failed to create udev library context.Lock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory locking (reserved memory: %zu stack: %zu).Skipping %slocking of memory maps (running in VALGRIND).Raised task priority %d -> %d.WARNING: setpriority %d failed: %s.Entering critical section (%s).Entering prioritized section (%s).Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory unlocking (reserved memory: %zu stack: %zu).Internal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Internal error: Missing command.wait4 child process %u failed: %sUnexpected errno: %d on lockfile open, returning runningUnexpected errno: %d on lockf, returning runningdbus daemon not running, not notifyingorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %ddevice_countstripe_count Mirrors %umirror/mirrored.c Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations: Raid Data LV%2d Raid Metadata LV%2d %smirror_countextents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %uFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.device_mapper/libdm-report.creport/report.craid4Unsupported raid type %s.locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesraid0_lvsstripe_sizemin_recovery_ratemax_recovery_rateNo areas found for segment %s_rmeta_raid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %uRaid transient status %s.time_now@%ld:@%ldFreeing VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255STDINmisc/lvm-exec.cwaitpidsync_dir failed in strdup%s: write error_undo_flock %sUnlocking %sflock_drop_shared_flock %s.SIG_SETMASKsigprocmasksigaction_block_signals_do_flock %s %c%cGiving up waiting for lock.pvmovelog uuid pool_strdup failedmisc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandomLocking memory%s/self/mapsproc_dir too longgetprioritysuspendingUnlocking memoryExecuting:%sforkexecvpChild %u exited abnormally%s failed: %u/var/lock/lvm/lvmdbusdLVM_DBUSD_LOCKFILEnotify/lvmnotify.cFailed to connect to dbus: %dcom.redhat.lvmdbus1Notify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %s/LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libedit.so./libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./libzstd.so./etc/selinuxHHHH;HzH%HSHDHHGH'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)cachecrypterrorlinearmirrorsnapshotsnapshot-originsnapshot-mergestriped zero writecache integrity thin-pool thinvdoraid0raid0_metaraid1raid10raid4raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6_n_6raid6_zrraid6_nrraid6_ncraid6_ls_6raid6_rs_6raid6_la_6 raid6_ra_6raid5raid6raid10_nearD-Bus notification failed[vdso][vsyscall][vectors]pvmovesnapshot_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_vorigin0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-shrinkingrebuild+emptymetreshapingqueueallocatableextendablepartialinitial image syncconvertingallocation lockedfixed minormerge failedsnapshot invalidlive table presentinactive table presentcheck neededskip activationhistoricalmergingimage syncedactive locallysharedFailed to get segtype name.writeableread-only-overriderefresh neededmismatches existwritemostlyout_of_datalvname snprintf faileddm_pool_strdup failedunmanagedFailed to allocate buffer.active exclusivelyNo lv_raid found for lv_image %s lv_iorig %sNo raid seg found for lv_raid %s lv_image %s lv_iorig %sNo raid health for seg area %u lv_raid %s lv_image %s lv_iorig %sraid health %c for seg area %u lv_raid %s lv_image %s lv_iorig %sNo seg area found for lv_raid %s lv_image %s lv_iorig %sNo lv_image found for lv_iorig %sInternal error: Unknown discards type encountered.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.Failed to allocate buffer for host.Failed to allocate buffer for mode.Failed to create list of integrity settings.Failed to allocate buffer for time.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.unknown01snapshot-merge Device ID %usnapshot/snapshot.cmerging_storecow_storestriped/striped.ccow_store = "%s"merging_store = "%s"thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"snapshot-originzero/zero.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d: Discards %s Thin count %u Transaction ID %lu Zero new blocks %sdiscards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %d# linearstripethin_poolexternal_originMissing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Thin pool delete %u.Thin pool create_%s %s.Missing thin pool uuid %s.dm_build_dm_name failed-cmeta%s/%s%slv_dmpath snprintf failedRunning check command on %s-Vbetterolderabbrev_dup_uuid/uuid.chexnew UUIDLV percent: %sdataBlocksUsedlogicalBlocksUsedstatsVDO property %s = %lu%llu %llu %llu %lludevice_mapper/libdm-targets.c%llu %llu %sCached as inactive %s.dev_manager%sblock/dm-%u/holdersCached as not present %s.undefinedqueue when fullqueue if no spaceerror when fullerror if no spacero-overrider-overrideread-writeinactive tableinactivelive tableliveactive remotelyfixedundefUnique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Integrity settings.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Description of Device Type.Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Device Typesdevtype_Command LogInternal error: Unrecognized VDO write policy: %u.Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'.Target snapshot may leak metadata.snapshot string list allocation failedString list allocation failed for thin_pool.String list allocation failed for thin.zero module string list allocation failedCouldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.WARNING: Ignoring invalid string in config file %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.Failed to build uuid for pool LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Internal error: Segment %s has no pool.Internal error: Failed to add merged segment of %s.Device id %u is higher then %u.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Missing thin external origin uuid %s.Delaying resume for new external origin %s.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.dm_report_set_output_field_name_prefix: dm_pool_strdup failedUUID contains invalid character '%c'Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.Failed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) failedWARNING: Failed to query uuid with LIST.Number of segments in active LV %s does not match metadata.Checking VDO pool stats message for LV %s.Internal error: Corrupted message structure returned: start %d > end %dInternal error: Message response doesn't contain terminating NUL characterCannot parse %s in VDO DM stats message.Get read ahead request failed: device name unrecorded.WARNING: Cannot find matching %s segment for %s.WARNING: Detected %s segment type does not match expected type %s for %s.Failed to parse writecache params: %s.Failed to parse integrity params: %s.Getting device info for %s [%s].WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u).Internal error: striped add_target_line called with no areas for %s.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Skipping %s callback registration for command %s.Internal error: Registering unsupported pool callback.Failed to allocated path for callback.Failed to add device (%u:%u) to dtree.Tracking pending delete for %s-%s (%s).sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Cached as present %s %s (%d:%d).Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Tracking pending delete for %s%s%s (%s).Reserved value for undefined numeric value.Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronization log.For mirrors, the UUID of the LV holding the synchronization log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can receive (vdopool).Header size at front of vdopool.Deprecated use of REQ_SYNC for writes (vdopool).Deprecated write policy (vdopool).Physical Extent number of start of segment.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Logical Volume Device Info and Status Combinednoyes0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#global/thin_disabled_featuresdiscardsexternal_originblock_sizediscards_non_power_2 metadata_resize error_if_no_space @external_origin_extendthinthin-poolactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sLVM_SYSTEM_DIRlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %sFail to any PVs for VG %sVG %s find PV device %smissing_%d_%dPrelAdding new LV %s%s%s to dtreecryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-Syncing device names origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s. abortmerge_thinprogress_infoin_progressreasonsignalnot_foundpath_num = %ldFailed to create pvs request.path[%d] = %%svg_name = %spid = %ldinit_vgvg_lock_type = %sVG %s init failed: %dvg_lock_argsNo internal lvmlock LV found.Cannot open sanlock LV %s.Failed to refresh %s.find_free_locklv_size_bytes = %ldUnsupported sector size %u.Failed to create internal lv.opts = %salign_mb = %ldvg_lock_args = %sUnknown lock_type.Failed to unlock LV %s/%s.VG not removed.free_vgadoptadopt_onlynodelay,start_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dpersistent,lvextendlvresizelvchangeLocking failed for LV %s/%sRefresh lvmlockinit_lvprev_lv_args = %slv_uuid = %slv_name = %slv_lock_argslv_lock_args not returnedfree_lvlv_lock_args = %s_free_lv lvmlockd result %dlockd global mode %slock_glRetrying %s global lockGlobal lock failed: error %dGlobal lock failed: error %d.Using error for pending delete of %s-%s.Couldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).%s not found in config: defaulting to "%s"Fail to allocate PV list for VG %sFail to allocate PV path for VG %sAborting. LV %s is incomplete and --activationmode partial was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment.Internal error: _emit_target cannot handle segment type %s._add_new_lv_to_dtree: pool alloc failed for %s %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot origin uuid %s.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Skipping users for already added external origin LV %s.Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.No space to stack fs operationInternal error: Cannot create tree for %s.Partial dtree creation failed for %s._clean_tree: Couldn't split up device name %s.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s._clean_tree: Failed to duplicate uuid.Successfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid set.Internal error: Use of lvmpolld requires vgname set.Internal error: Use of lvmpolld requires lvname set.Asking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Use of lvmpolld requires uuid being set.Asking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.For more information see lvmpolld messages in syslog or lvmpolld log file.Polling finished successfully.VG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: vg_write vg_commitVG %s init failed: lock_args alloc failedHandle sanlock LV %s path too long.Cannot get size of sanlock LV %s.Refresh sanlock lv %llu dm %lluExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.Invalid host_id %d, use 1-250 (sanlock_align_size is 1MiB).Invalid host_id %d, use 1-500 (sanlock_align_size is 2MiB).Invalid host_id %d, use 1-1000 (sanlock_align_size is 4MiB).Invalid host_id %d, use 1-2000 (sanlock_align_size is 8MiB).Invalid sanlock_align_size %u, use 1,2,4,8.Invalid host_id %d, use 1-2000.VG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesFailed to deactivate sanlock lv %s/%sUsing sector size %u for sanlock LVLV %s/%s must be inactive on all hosts.Force unprotected removal of shared VG? [y/n]: Cannot change VG %s with active LVsCannot free VG sanlock, lvmlockd is not in use.Cannot free VG sanlock, lvmlockd is not connected.Global lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_argsLockspace for "%s" not stopped on other hosts_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.VG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %sFailed to activate sanlock lv %s/%sVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdLV locks are not allowed with readonly option.WARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %s %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sLV %s/%s lock failed: orphan lock needs to be adopted.LV %s/%s lock failed: adopt found no orphan.LV %s/%s lock failed: adopt found other mode.WARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd free LV %s/%s %s lock_args %sExclusive locks are not allowed with readonly option.Reading without shared global lock.Global lock failed: check that lvmlockd is running.lockd global mode %s already held.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesGlobal lock failed: orphan lock needs to be adoptedGlobal lock failed: adopt found no orphanGlobal lock failed: adopt found other modeSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: orphan lock needs to be adoptedSkipping global lock: adopt found no orphanSkipping global lock: adopt found other modeSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedGlobal lock failed: held by other host.8``t4***lV*****@PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANvdo_poolvdo_offsetvdo_pool = "%s"vdo_offset = %u Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sUnknown logical volume %s.block_map_era_lengthheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sV%u %*s %lu %*u %uMissing VDO's data uuid %s.dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataDumping configuration to %sFailure while writing to %slvchange.c and %u other snapshot(s)Failed to prepare message.Skip LV unlock: no lvmlockdSkip LV unlock: no lockspaceNo vdo pool for %s/%sidlefrozenresyncrecovershupdatenorefreshskipglskipvgskiplvautonowaitadoptlsadoptgladoptvgadoptlvnodelay_longcommand.cStringSelect--uuidstr prev ... -%c|%s (, %c%c [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ COMMON_OPTIONS ] [(inherited)disabled%s:yLogical volume %s changed.No settings changed.disk-logged core-logged clustered Failed to clear %s %s for %s.intermediateMonitoring LV %sUnmonitoring LV %sPolling LV %sdevtypesdumpconfigformatsfullreportDisplay full reporthelpDisplay help for commandslastlogChange logical volume layoutlvcreateCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfigManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvreducelvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvspvscanList all physical volumessegtypesList available segment typessystemidvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitThe name of a cache pool. The name of a cache volume. The size of cache to use. See \fBlvmreport\fP(7). No longer used. Display long help text. Output columns as rows. The name of a thin pool LV. Display version information. Display help text. Only report PVs. ERRy|n[+|-]Number[+]Numberpartial|degraded|completey|n|ayauto|1|2passdown|nopassdown|ignorecore|disk[+|-]Size[k|UNIT][+|-]Size[m|UNIT][+]Size[m|UNIT][-]Size[m|UNIT][+|-]Number[PERCENT][+]Number[PERCENT][-]Number[PERCENT]rw|rsanlock|dlm|noneauto|none|Numberall|unmanaged|NumberPV[:t|n|y]check|repairbasic|json|json_stdlog|vg|lv|pv|pvseg|segnone|abbrev|full|0|1|2Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.Internal error: Passed segment is not VDO type.Internal error: Passed segment is not VDO pool.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.String list allocation failed for VDO module.Only one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type list--valuesonly has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.Failed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundOperation not permitted on hidden LV %s.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Cannot change LV properties when activating component LVs.WARNING: Combining activation change with other commands is not advised.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Lock on incorrect thin lv type %s/%sCannot find thin pool for %s/%sLock on incorrect vdo lv type %s/%sInternal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Ignoring unknown lockopt value: %sParsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown opt arg: %s.Parsing command defs: unknown pos arg: %s.Too many args, increase CMD_RO_ARGS.Too many args, increase CMD_OO_ARGS.Too many args, increase CMD_IO_ARGS.Parsing command defs: option %s must be followed by an arg.Parsing command defs: options must be specified in long form: %s.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.Read ahead is already auto for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum, adjusting.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.A raid LV with integrity is required.No integrity found in specified raid LV.LV must be inactive to change integrity settings.Clear all integrity settings? Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Logical volume %s is not active.Failed to change monitoring for %s volume.Refreshing logical volume %s (if active).Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume group#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. When used alone, --deldev specifies a device name. When used with --deviceidtype, --deldev specifies a device id. Remove devices file entries with no matching device. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. This option is used when automatically importing devices for the root VG. The auto import is intended to be done once, on first boot, to create an initial system.devices file for the root VG. When this option is used, the vgimportdevices --rootvg command does nothing if system.devices exists, or the file auto-import-rootvg does not exist (both in the \fI#DEFAULT_SYS_DIR#/devices/\fP directory.) Specify if autoactivation is being used from an event. This allows the command to apply settings that are specific to event activation, such as device scanning optimizations using pvs_online files created by event-based pvscans. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Control file system resizing when resizing an LV. \fBchecksize\fP: Check the fs size and reduce the LV if the fs is not using the reduced space (fs reduce is not needed.) If the reduced space is used by the fs, then do not resize the fs or LV, and return an error. (checksize only applies when reducing, and does nothing for extend.) \fBresize\fP: Resize the fs by calling the fs-specific resize command. This may also include mounting, unmounting, or running fsck. See --fsmode to control mounting behavior, and --nofsck to disable fsck. \fBresize_fsadm\fP: Use the old method of calling fsadm to handle the fs (deprecated.) Warning: this option does not prevent lvreduce from destroying file systems that are unmounted (or mounted if prompts are skipped.) \fBignore\fP: Resize the LV without checking for or handling a file system. Warning: using ignore when reducing the LV size may destroy the file system. Control file system mounting behavior for fs resize. \fBmanage\fP: Mount or unmount the fs as needed to resize the fs, and attempt to restore the original mount state at the end. \fBnochange\fP: Do not mount or unmount the fs. If mounting or unmounting is required to resize the fs, then do not resize the fs or the LV and fail the command. \fBoffline\fP: Unmount the fs if it is mounted, and resize the fs while it is unmounted. If mounting is required to resize the fs, then do not resize the fs or the LV and fail the command. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Type of headings to use in report output. \fBnone\fP or \fB0\fP: No headings. \fBabbrev\fP or \fB1\fP: Column name abbreviations. \fBfull\fP or \fB2\fP: Full column names. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Change the VG system ID if the majority of PVs in the VG are present (one more than half). Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. See also additional --refresh option for use in udev environment. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in response to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. Disable locking. Use with caution, concurrent commands may produce incorrect results. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronization. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. Use VDO type volume for pool data volume. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Prevent the command from making changes, including activation and metadata updates. (See --permission r for read only LVs.) #lvmdevices Search for missing PVs on new devices, and update the devices file with new device IDs for the PVs if they are found on new devices. This is useful if PVs have been moved to new devices with new WWIDs, for example. The device ID type and name may both change for a PV. WARNING: if a PV is detached from the system, but a device containing a clone or snapshot of that PV is present, then refresh would replace the correct device ID with the clone/snapshot device ID, and lvm would begin using the wrong device for the PV. Use deldev/adddev to safely change a PV device ID in this scenario. #vgchange #lvchange #vgmknodes #vgscan If the LV is active, reload its metadata. In an environment where udev is used to manage the /dev content, usage of this option is highly recommended. This is because refresh also regenerates udev events for an LV based on which existing udev rules are applied to set the /dev content and permissions. Also, this operation may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. \fBjson_std\fP produces report output in JSON format which is more compliant with JSON standard. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. Import devices used for the root VG. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. Mind that these synchronization actions are transient and have to be restarted after a system failure/reboot or a configuration change to the RaidLV. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable kernel options for dm-cache or dm-writecache LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --cachesettings for each option being set. These settings override the default kernel behaviors which are usually adequate. To remove cachesettings and revert to the default kernel behaviors, use --cachesettings 'default' for dm-cache or an empty string --cachesettings '' for dm-writecache. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. When printing config settings, print only values without keys. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. #pvs Show information about PVs outside the devices file. Combine with -a|--all to include devices that are not PVs. #pvscan Show information about PVs outside the devices file. Displays the device ID for PVs included in the devices file. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4 KiB and 512 KiB and the default value is 4. For a cache pool the value must be between 32 KiB and 1 GiB and the default value is 64. For a thin pool the value must be between 64 KiB and 1 GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128 MiB, if the pool metadata size is not specified. The value must be a multiple of 64 KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. Specifies tunable kernel options for dm-integrity. See \fBlvmraid\fP(7) for more information. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck when resizing the file system with --resizefs. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize the fs using the fs-specific resize command. May include mounting, unmounting, or running fsck. See --fsmode to control mounting behavior, and --nofsck to disable fsck. See --fs for more options (--resizefs is equivalent to --fs resize.) Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128 KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128 KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4 KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4 KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_search04(4(4(404(4(4@44(44QPPPPPPGUPPPPTPPPPPPPPPPP4TPPPPPSQRPPPPPPlSPPPPPPPPPPPPPPPPPPPPPPPPP7RPPPPPPRPP7R !*"NDgK#'linearstripedsnapshotcachecachepoolintegritymirrorraidraid0 raid1 raid10 raid4 raid5 raid6thinthinpoolvdovdopoolvdopooldatawritecachezeroerrorglobal/vdo_disabled_featuresonline_renameversion4kvdoInternal error: Missing function for command definition %d:%s.Failed to get '--replace' argumentDo you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Cannot convert %s LV %s to %s.Thin repair command is not configured. Repair is disabled.Cannot repair active pool %s. Use lvchange -an first.Failed to build thin metadata path.Failed to build pool metadata spare path.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Can't prepare new metadata name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.Only inactive cache can be repaired.Cache repair command is not configured. Repair is disabled.Failed to build cache metadata path.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.Failed to initialize processing handle.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearInternal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Cannot specify mirrors with linear type.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Internal error: Unknown mirror log count %d.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesSplitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Only up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.Unable to find image to satisfy request.Unable to split additional image from %s while tracking changes for %s.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?LV %s has no suffix for cachevol (skipping rename).%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Failed to activate %s. Conversion cannot proceed.Aborting. Failed to deactivate new thin LV. Manual intervention required.Aborting. Failed to swap identifiers. Manual intervention required.Aborting. Failed to attach external origin. Manual intervention required.Converted %s to thin volume with external origin %s.Failed to deactivate thin LV %s.Failed to deactivate thin LV. Manual intervention required.Internal error: LV %s is already a pool.Cannot convert logical volume %s.Can't use same LV for pool data and metadata LV %s.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is of an unsupported type.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Volume of "%s" segtype cannot store ANY real data!THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Do you really want to convert %s? [y/n]: Aborting. Failed to deactivate %s.Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Failed to set up spare metadata LV for pool.Volume %s is already VDO volume, skipping VDO conversion.Aborting. Failed to deactivate metadata lv. Manual intervention required.Failed to create internal lv names, %s name is too long.Cannot allocate lock for new pool LV.Failed to lock new pool LV %s.Failed to activate pool logical volume %s.Manual intervention may be required to handle reported errors.Failed to unlock pool data LV %s/%sFailed to free lock for pool data LV %s/%sFailed to unlock pool metadata LV %s/%sFailed to free lock for pool metadata LV %s/%sWARNING: Converting %s to fully provisioned thin volume.Pool metadata extents %u chunk_size %uWARNING: Converting %s to %s pool's data%s %s metadata wiping.Convert poll ID list allocation failed.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Volume %s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.Conversion starts after activation.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Internal error: Cannot get origin from %s COW.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Merging of snapshot %s will occur on next activation of %s.lvconvert.cNo --rebuild found!raid0-i-otransaction="%s_meta%%dManual repair required.ConvertedMerged_mimagetmp_%dlayer name creation failed.Failed to insert resync layerNo usable images left in %s.Setting logging type to %s.Logical volume %s converted.raid1 with reducingenhancingLogical volume %s NOT split.Cannot convert LV %s.Conversion aborted.Volume %s replaced origin %s. and withWITHOUT and metadata volumesMetadata LV %s not found.Unknown pool metadata LV %s.Can't convert locked LV %s.pool_metadata%d_tpool%dConverted %s to %s %s.replaceMerging of volume %s started.nonedevtypes_generalformats_generalfullreport_generalhelp_generallastlog_generallvchange_activatelvchange_monitorlvchange_persistentlvchange_poll lvchange_properties lvchange_rebuild lvchange_refresh lvchange_resync lvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_combine_split_snapshotlvconvert_integritylvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshotlvconvert_merge_thinlvconvert_plainlvconvert_raid_typeslvconvert_repairlvconvert_replace_pvlvconvert_split_and_keep_cachelvconvert_split_and_remove_cachelvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_polllvconvert_swap_pool_metadata lvconvert_to_cache_with_cachepool!lvconvert_to_cache_with_cachevol"lvconvert_to_cache_with_device#lvconvert_to_cachepool$lvconvert_to_cachepool_or_swap_metadata%lvconvert_to_thin_with_data&lvconvert_to_thin_with_external'lvconvert_to_thinpool(lvconvert_to_thinpool_or_swap_metadata)lvconvert_to_vdopool*lvconvert_to_vdopool_param+lvconvert_to_writecache,lvconvert_to_writecache_with_device-lvcreate_and_attach_cachedevice_for_cache.lvcreate_and_attach_cachedevice_for_writecache/lvcreate_and_attach_cachepool0lvcreate_and_attach_cachepool_v21lvcreate_and_attach_cachepool_v32lvcreate_and_attach_cachevol_for_cache3lvcreate_and_attach_cachevol_for_writecache4lvcreate_cachepool5lvcreate_cow_snapshot6lvcreate_cow_snapshot_with_virtual_origin7lvcreate_error_vol8lvcreate_linear9lvcreate_mirror:lvcreate_mirror_or_raid1;lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool<lvcreate_raid_any=lvcreate_striped>lvcreate_thin_snapshot?lvcreate_thin_snapshot_of_external@lvcreate_thin_volAlvcreate_thin_vol_and_thinpoolBlvcreate_thin_vol_with_thinpool_or_sparse_snapshotClvcreate_thinpoolDlvcreate_vdo_volElvcreate_zero_volFlvdisplay_generalGlvextend_policyHlvextend_pool_metadataIlvextend_pvJlvextend_sizeKlvmchange_generalLlvmconfig_generalMlvmdevices_checkNlvmdevices_editOlvmdevices_listPlvmdevices_updateQlvmdiskscan_generalRlvmsadc_generalSlvmsar_generalTlvpoll_generalUlvreduce_sizeVlvremove_generalWlvrename_lv_lvXlvrename_vg_lv_lvYlvresize_pool_metadataZlvresize_pv[lvresize_size\lvs_general]lvscan_general^pvchange_properties_all_pvchange_properties_some`pvck_dumpapvck_generalbpvck_repaircpvck_repair_typedpvcreate_generalepvdata_generalfpvdisplay_generalgpvmove_anyhpvmove_oneipvremove_generaljpvresize_generalkpvs_generallpvscan_cachempvscan_displaynsegtypes_generalosystemid_generalptags_generalqversion_generalrvgcfgbackup_generalsvgcfgrestore_by_filetvgcfgrestore_by_vguvgcfgrestore_list_by_filevvgcfgrestore_list_by_vgwvgchange_activatexvgchange_lockstartyvgchange_lockstopzvgchange_locktype{vgchange_monitor|vgchange_poll}vgchange_properties~vgchange_refreshvgchange_systemidvgck_generalvgck_update_metadatavgconvert_generalvgcreate_generalvgdisplay_generalvgexport_allvgexport_somevgextend_generalvgimport_allvgimport_somevgimportclone_generalvgimportdevices_allvgimportdevices_rootvgimportdevices_somevgmerge_generalvgmknodes_generalvgreduce_allvgreduce_by_pvvgreduce_missingvgremove_generalvgrename_by_namevgrename_by_uuidvgs_generalvgscan_generalvgsplit_by_lvvgsplit_by_pvcountInternal error: Unknown pool conversion.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Unable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Internal error: Invalid lvconvert pool commandLV %s could not be converted to a thin volume.No cachedevice specified to create a cachevol.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.LV %s is already used as a cachevol.Erase all existing data on %s? [y/n]: Redirecting operation to data sub LV %s.Can't prepare new cachevol name for %s.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Failed to unlock fast LV %s/%sOperation not permitted on LV %s type %s.LV %s with type %s cannot be converted to a cache pool.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.Cannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set writecache cleaner for %s.Failed to set cleaner cachesettings to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Internal error: Cannot detach writecache.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.WARNING: Converting logical volume %s to VDO pool volume %s formatting.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Converted %s to VDO pool volume and created virtual %s VDO volume.Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Path name too long to get LV block size %sTest mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to activate LV to check block size %sFailed to deactivate LV after checking block size %sCannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Cannot add integrity while LV is missing PVs.Cannot add integrity to non raid type LV %s.Logical volume %s has added integrity.LV %s does not have integrity.Cannot remove integrity from non raid type LV %s.Logical volume %s has removed integrity.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesFailed to remove temporary sync layer.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.LV %s with type %s cannot be used as a metadata LV.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.New pool metadata LV %s cannot be locked.Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Internal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.Failed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.Inconsistent volume group names given: "%s" and "%s"Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Logical volume %s not split.WARNING: %s not zeroed.LVM_VG_NAMEvg/lv string alloc failed.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolUse cache metadata format 2.Cache pool %s not found.Thin pool %s not found.Cannot find cache %s.Invalid writecache settings.Failed to update VG.MemTotal:%*s%llu%*sInvalid cachevol LV.LV %s could not be zeroed._wcoriglvconvert_poll.c%s: %s: %s%%LV %s is not merged.pvmove_tmetalvcreate.cskipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%sThere's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Mirror log type "%s" is unknown.%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dIncompatible options selected.Options -c and -m are incompatible.Size may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Extents may not be relative/signed../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --with-default-use-devices-file=1 --disable-silent-rules --enable-app-machineid --enable-editline --disable-readlineFiltering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: remove multipath componentAdding multipath device %s for multipath component %s.Missing multipath device %s for multipath component %s.PRODUCT_UUID=%s (old %s): updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: device not foundIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: no changeIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s (%s) IDNAME=%s (%s) DEVNAME=%s (%s) PVID=%s%s: device not foundIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: indeterminateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: old entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: new entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: deleteUpdated devices file to version %sNo update for devices file is needed.Updates needed for devices file.Hash update needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.WARNING: to remove a device by device id, include --deviceidtype.Device %s is used by an active LV, continue to remove? WARNING: to remove a device by name, do not include --deviceidtype.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%sNo devices file entry with device id %s %s.Multiple devices file entries for PVID %s (%s %s), remove by device name.PVID not found in devices file.Option --minor may not be repeated.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Ambiguous syntax, please create --type cache-pool %s separately.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.Selected cache metadata format %d is not supported.Command definition index %d enum %d id %sInternal error: Command %s not found. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.) Use --longhelp to show all options and advanced commands.Use 'lvm help ' for more informationArgument%s%c%s%s cannot be used in interactive mode.Option%s%c%s%s may not be repeated.Unable to allocate memory for command line arguments.--partial and --activationmode are mutually exclusive argumentsPARTIAL MODE. Incomplete logical volumes will be processed.Invalid activation mode given.WARNING: Ignoring unknown search_for_devnames setting, using %s.A --devices list cannot be used with --devicesfile.Failed to read --devices args.Failed to copy devices file name.Command profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.stub.hlvmcmdline.csystem ID: %slnyljsonpvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sIncompatible options selectedlvdisplay.cSize may not be negative.Size may not be positive.Region size may not be zero.Extents may not be negative.Extents may not be positive.LVM version: %s1.02.202-RHEL9 (2024-11-04)Library version: %sDriver version: %sConfiguration: %slvmdevices.cFound PVID %s on %s.Devices file not enabled.Devices file does not exist. PART=%dPRODUCT_UUID=%s: addPRODUCT_UUID=%s: removeHOSTNAME=%s (old %s): updateHOSTNAME=%s: addHOSTNAME=%s: removeNo device found for %s.Failed to read %s.Invalid PVID.Device not removed.No devices file entry for %s.Unknown device_id type.Option %s %s., %ORIGINwith generated name as snapshot of toollib.cFailed to remove new LV %s.Number may not be negative. Common options for lvm: Common options for command:%s: no such command.%s - %s Available lvm commands:%-16.16s%s -Option requires argument.Invalid argument for %s: %sUnrecognised option %d (%c).Invalid devices file name.Invalid units specification~0} yxhx~:hʬhhhhhhhhh;Failed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profilemetadata profileGiving preference to command profile specified on command line over the one specified via environment variable.LVM_COMMAND_PROFILEWARNING: only considering LVM devices%d LVM physical volume whole disk%sWARNING: Ignoring lvscan --cache because lvmetad is no longer used.Please enter one or more logical volume paths or use --select for selection.Removing devices file entry for device_id %sExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageRenamed "%s%s" to "%s%s" in volume group "%s"Existing historical logical volume "%s" not found in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differInternal error: unknown lvresize typeOptions --fs and --resizefs cannot be used together.--resizefs is equivalent to --fs resize.The --fsmode option does not apply to resize_fsadm.Please specify either size or extents but not both.Ignoring type, stripes, stripesize and mirrors arguments when reducing.Mirrors argument may not be signed.Stripes argument may not be negative.Cannot use stripes with linear type.Stripesize may not be negative.Logical volume %s successfully resized.lvextend policy is supported only for snapshot, thin pool and vdo pool volumes.lvextend using policy requires the volume to be active.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set below minimal supported value 50%%.lvextend policy disabled by threshold 100Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.lvextend policy calculated percentages main %u meta %u from threshold %d percent %dRefreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.VG changed during file system resize, LV not resized.ABORTING: Mirror percentage check failed.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.--polloperation parameter is mandatoryArgument to --interval cannot be negativePoll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.Resolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Metadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Cannot disable all metadata areas in volume group %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uSetting mda_copies to %u for VG %sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Failed to set pvid for devices file.Failed to update devices file.Marking metadata areas on physical volume "%s" as %s.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedCHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerArgument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldForking background process from command: %sWARNING: Failed to set SIGCHLD action.Background process failed to setsid: %sCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluFound bad header or metadata values.CHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.WARNING: No LVM label found on %s. It may not be an LVM device.Failed to read label_header at %lluWriting label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Could not find LVM label on %sFound text metadata area: offset=%llu, size=%lluMetadata text %llu too large for mda_size %llu max %llulvresize.cpvck.clvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"%-*s [%15s] %sLVM physical volume%d disk%s%d partition%s%d LVM physical volume%slvscan.clvremove.cFailed to read devices fileFailed to write devices filelvrename.cUnknown --fs value.Unknown --fsmode value.lvextend policy not needed.refresh_lvpath = %sLV refresh failed for LV %sACTIVE OriginalSnapshot %s%s '%s%s/%s' [%s] %spolldaemon.cCan't find LV in %s for %s.lvpoll.cProvide LV nameMovedUnknown polling operation %sMissing LV uuid within: %s/%spvchange.cChanging uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedignoredin-useSkip writing in test mode.Failed to write new mda textafterfork failed: %sredirectLVM_EXPECTED_EXIT_STATUS(lvm2)?mda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llu LVM2 x[5A%r0N*>Failed to create file %sFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda_sizemda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# Generatedid = No mda location.zero metadata copiesUnknown dump value.Write LVM header to device? Write new LVM header to %s? Failed to write new headerUnknown repair value.pб/dev/null LVM2 x[5A%r0N*>Please enter a physical volume pathWARNING: skipping global lock for force.--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %sDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPlease supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedOptions -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Option -c not allowed with option -mOption -c is not allowed with option -sFailed to clone VG or LV name.Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segment--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Internal error: Unexpected LV index %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Matched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uMoving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Incompatible layer boundary: %s:%u[%u] on %s:%u.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Unable to move device used for writecache cachevol %s.Inserting layer %s for segments of %s on %slayer segment for %s:%u not found.No extents available for allocation.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / ABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.Internal error: Invalid resize params.Physical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Use pvcreate and vgcfgrestore to repair from archived metadata.PV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]pvscan[%d] %s: autoactivation failed.Wrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device set up for online PV %d:%d %s PVID %spvscan[%d] No device set up for online PV %d:%d %s PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sIgnoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.Skip pvscan for unknown autoactivation value.pvscan[%d] Skip pvscan for unknown autoactivation value.Skip pvscan for event with event_activation=0.pvscan[%d] Skip pvscan for event with event_activation=0.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.WARNING: Invalid major:minor %d:%d, skipping.No device set up for arg %s %u:%u.pvscan[%d] No device set up for arg %s %u:%u.pvscan_cache_args: filter devs nodataFinding symlink names from DEVLINKS for filter regex.Finding symlink names from /dev for filter regex.pvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.Failed to write lookup entry %s %spvscan[%d] Failed to write lookup entry %s %sset_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for online PV %d:%d %spvscan[%d] VG %s PV %s no device found for online PV %d:%d %sset_pv_devices_online vg %s pv %s is online %spvscan.cpvremove.cpvcreate.cNEW (exported)(but full)pvdisplay.c--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %u--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEpvresize.cof exported volume group(s)in no volume grouppvmove.cpvmove_poll.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.Inserting %s:%u-%u of %s/%sNo data to move for %s.Failed to activate %sanyLayer is not linear: %s:%uMissing error segtypelv_list alloc failedRemoving temporary pvmove LVLayer segment found: %s:%u%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*sPV %-*s VG %-*sPV %-*s %-*s %-10s %sPV %-*s VG %-*s %-10s %sPV %-*s %-*s %s [%s]Remove pv online devno %u:%uUnlink pv online %spvscan autoactivating VG %s.%s: autoactivation failed.LVM_EVENT_ACTIVATION=0pvscan_recreate_hints_beginDEVLINKSDEVLINKS %spvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowreporter.c and its SubLV(s)Failed to allocate lvid.Failed to clone LV name.Did not create %s: %dwrite_lookup_file %sreport_optionsInvalid options string: %sUnknown --headings value.%s: unknown report format.report_groupFailed to create log report.No log report stored.use_unknown Skipping volume group %sAllocation of vg_name failed.Disabling%s pool zeroing.Setting pool discards to %s.may not be negativemay not be zeroUsing default stripesize %s.Invalid stripe size %s.Unknown VDO setting "%s".Failed to get tag.Failed to add tag %s to %s/%ssuccessfailureProcessing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sSelection failed for VG %s.Running command for VG %s %sInterrupted.Failed to find device "%s".dev_iter creation failed.Show help.Internal error: _report_all_in_vg: incorrect report type %u.Unknown report specifier in report option list: %s.Internal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.Supported report formats: %s, %s, %s.dm_report: dm_report_init_group: failed to allocate mem poolFailed to create report group.Failed to add log report to report group.Failed to set log report name for command context.dm_report: failed to allocate root report group itemdm_report: failed to allocate report group structureFailed to set selection for log report.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.WARNING: Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.WARNING: Using unrecognized writecache setting: %s = %s.skip_dev_dir: Couldn't split up device name %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.WARNING: Skipping clustered VG %s.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCannot access clustered VG %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sSpawning background pvmove process for %s.Spawning background lvconvert process for %s.Failed to allocate poll identifier for lvconvert.Delaying merge for origin volume %s since snapshot volume %s is still active.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Invalid lvm.conf writecache setting value for %s.High watermark must be greater than low watermark.Invalid raid integrity journal size %d MiB (use 4-1024 MiB).Logical volume %s/%s does not support tagsFailed to add tag %s to physical volume %s.Failed to duplicate tag %s from %s/%sPlease use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleInternal error: _report_all_in_lv: incorrect report type %u.Internal error: _report_all_in_pv: missing pv.Internal error: _report_all_in_pv: incorrect report type %u.Internal error: report_for_selection: incorrect report type %uMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Use VG uuid in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sObtaining the complete list of VGs to processRepeat lock and read for local to shared vgWARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.dm_report: Unrecognized field: %.*sFailed to compact given columns in report output.No physical volume label read from %s.Failed to add main report section to report group.Failed to finalize main report section in report group.reportVolume group allocation policy is already %svgchange_metadata_copies new %u vg_mda_copies %u D %uWARNING: Number of metadata copies for VG %s is already unmanaged.WARNING: Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group autoactivation is already %s.Can't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.Volume group "%s" successfully backed up.No backup taken: specify filename with -f to backup with unknown segments.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.WARNING: Physical extent size cannot be larger than %s.WARNING: Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Volume group has active logical volumes.Failed to generate new random UUID for VG %s.Changing configuration profile for VG %s: %s -> %s.Ignoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Invalidating devs for any PVs on LVs.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)WARNING: Command on LV %s does not accept LV type %s.WARNING: Command on LV %s does not accept LV type unknown (%d).Command not permitted on LV %s.WARNING: Command on LV %s has invalid use of option %s.WARNING: Command on LV %s requires option %s.WARNING: Command on LV %s uses options invalid with LV type %s.WARNING: Command on LV %s with invalid LV type %s.WARNING: Command on LV %s uses options that require LV types %s.WARNING: Command on LV %s does not accept LV type %s. Required LV types are %s.WARNING: Command on LV %s uses options that are invalid with LV properties: %s.WARNING: Command on LV %s is invalid on LV with properties: %s.WARNING: Command on LV %s uses options that require LV properties: %s.WARNING: Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"Failed to allocate final LV list item.Processing lockd_sanlock_lv %s/%s.Tags cannot be used with this command.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.device_list element allocation failedProcessing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openWiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.Set up physical volume for "%s" with %lu available sectors.Format-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sFailed to setup physical volume "%s".Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.delete dev from initial duplicates %sdelete dev from unused duplicates %sDuplicate device name found on input: %s.Checking %s for pvremove %.32s.Checking %s for pvcreate %.32s.pv_list allocation in pv_create failedPhysical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.WARNING: VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Failed to get result from lvmlockdFailed to find a running lock manager.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.%d logical volume(s) in volume group "%s" now activeVolume group "%s" successfully changed.%d logical volume(s) in volume group "%s" %smonitoredIgnoring invalid string in lock_start list.Ignoring empty string in config file.vgchange.cFailed to allocate filename.vgcfgbackup.cvgcfgrestore.cNo archives found in %s.Restore aborted.Restore failed.Restored volume group %s.(no profile)Selection failed for LV %s.Processing LV %s in VG %s.Processing each PVCannot use %s: %sProcessing PVs in VG %sSelection failed for PV %s.Skipping PV %s in VG %s.Processing PV %s in VG %s.Processing device %s.device_id_list alloc failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclCannot read orphans VG %s.alloc pvl failed.Using existing orphan PV %s.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.strdup failed.Failed to find PV %sFound root dm_uuid %srunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmlock_type %s is invalidSetting lock_type to %sDeaVG %s is incomplete.%s/devices/auto-import-rootvgFound %s creating %s/run/lvm/lvm-devices-importfailed to create %sRefreshing volume group "%s"Physical extent size may not be negative.Please supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.Please supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.Need one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinit.Only -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negative.Physical extent size may not be negative.Change clustered property of all volumes groups? [y/n]: Skip vgchange for unknown autoactivation value.Skip vgchange for event and event_activation=0.Failed early VG locking for autoactivation.Finding online devices to scanNo device found for quick mapping of online PV %u:%u %s PVID %s.Repeat dev cache scan to translate devnos.No device found for %u:%u PVID %s.label_scan_vg_online: read and filter devsMatch device_id %s %s to %s: matching PVIDIncomplete PV list from online files %d metadata %d.PVs online error%s%s, using all devices.PVs online not found for VG %s, using all devices.PVs online incomplete for VG %s, using all devices.WARNING: New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sForcibly change VG lock type to %s? [y/n]: Using lock type requires lvmlockd.Not starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvUsing lock start and lock stop requires lvmlockd.No global lock for lock start.Starting locking. VG can only be read until locks are ready.Starting locking. Waiting for sanlock may take a few seconds to 3 min...Starting locking. Waiting until locks are ready...Cannot change system ID without the majority of PVs (found %d of %d).Volume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Internal error: lvmcache_get_bad_mdas no vginfo %sWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.The volume group is missing %d physical volumes.Volume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedPlease provide volume group name and physical volumesThe clustered option is deprecated, see --shared.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Global lock failed: lockspace is starting.VG create failed: lock manager %s is not supported by lvmlockd.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.Failed to allocate memory for system_id in vg_set_system_id.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)WARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedWARNING: PV %s not found in VG %sWARNING: PV %s was not missing in VG %sPlease enter volume group name and physical volume(s)Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedChecking for volume group "%s"vgmerge not allowed for lock_type %sNot importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Temporary vg name %s1 is too long.Internal error: Old vg name %s is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Root VG auto import is not enabled.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file for root VG %s.Added %u devices to devices file.Please enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Marking PV %s as moved to VG %sFailed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedFailed to clear metadata from physical volume "%s" after removal from "%s"Removed "%s" from volume group "%s"Removing "%s" from volume group "%s"Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"vgexport.cvgimport.c for VG No volume groups changed.Skipping device_id filteringVG lock type not changed.lockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dUnable to set system ID.Failed to write VG.vgck.cFailed to commit VG.Volume group %s not changedvgextend.c with system ID vgcreate.clockd global lock_type %sEnabling sanlock global lockFailed to get tagFailed to start lockingvgreduce.cr/wexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Physical volumes ---vgdisplay.cNo PV has been restored.vgmerge.cvgimportdevices.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.Failed to unlink %sFailed to find root VG.No devices to add.Changed LVID for %s to %sRefresh failed for %s.vgmknodes.cNo device found for PV.vgreduce_single VG %s PV %sWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)Please enter one or more volume group paths or use --select for selection.New VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sLVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRenaming path is too long %s/%s %s/%slockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Volume group "%s" successfully renamed to "%s"Failed to restart VG %s lockspace.Old and new volume group names need specifyingNew volume group path exceeds maximum length of %d!Old and new volume group names must differFound %svolume group "%s" using metadata type %sCannot notify dbus: notify_dbus is disabled in lvm config.WARNING: Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Can't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groups%s volume group "%s" successfully split from "%s"Can't split Logical Volume %s between two Volume GroupsThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.The %s "%s" should be mangled but it contains blacklisted characters._do_dm_ioctl_unmangle_string: failed to unmangle %s "%s"Hex encoding mismatch detected in %s "%s" while trying to unmangle it.%s: Wrong device number: (%u, %u) instead of (%u, %u)Too many arguments. Limit is %d.Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dError during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).MESSAGE_ID=3ca432788c374e4ba684b834188eca36Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sUpdated config file invalid. Aborting.DEGRADED MODE. Incomplete RAID LVs will be processed.--ignoremonitoring or --sysinit option not allowed with --monitor option.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Path for locking_dir %s is invalid.File locking initialisation failed.WARNING: Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dmpath hash table creation failed.multipath wwids file disabled.Ignore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.Run `%s --help' for more information.Failed to strdup command basename.Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit formInternal error: Daemon send: socket fd cannot be negative %dInternal error: Daemon send: no memory availableInternal error: Bad format string '%s'Target type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedCould not determine kernel version used.Failed to set up list of device-mapper major numbersFailure to communicate with kernel device-mapper driver.Check that device-mapper is available in the kernel.Internal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronization interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device_mapper/libdm-timestamp.cdevice-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataFailed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.Attempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)dm_task_set_message: strdup failedvgremove.cVolume group "%s" not removedvgrename.cCan't get lock for %srename_vg_beforeRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedrename_vg_finalexported vgscan.cvgsplit.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not found\x5cx#+-.:=@_%2x%128s/proc/devices%u %255s %s: No entry for %s found%s: Wrong inode typeDM_DEBUG_WITH_LINE_NUMBERS%s:%d /run/lvm/lvmlockd.socketHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sMESSAGE=lvm command %sCODE_LINE=907PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sIgnore opt %dProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedmpath pool creation failed.LVM_LVMLOCKD_SOCKETCompleted: %s/run/lvmlockd.pidconfig-util.c%.*s= %ld %.*s= "%s" %b%.*s%s ## daemon-client.crequestFailed to duplicate node key._control_fdcontrol/proc/miscCreating device %s (%u, %u)mknod) UUID DM_DEVICE_RESUMEDM_DEVICE_REMOVEDM_DEVICE_RENAMEkey setenablechecks ima_measurement securedata deferredremove retryremove skiplockfs readonly noflush noopencount reload %u:%u diff type %s %sreload params1 %sreload params2 %sget_timestampclock_gettime(unknown version)DM_DEFAULT_NAME_MANGLING_MODEӍɍRyYG5create8reload 8remove8remove_all8suspend8resume8info8deps 8rename8version8status 8table 8waitevent8names8clear 8mknodes8versions 8message8setgeometry8armpoll8$target-version8)log_commandAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %dParse error at byte %td (line %d): expected a string token.Device %s (%u:%u) appears to be mounted on %s.Failed to clone string config value.dm_pool_grow_object failed for config linevsnprintf failed for config linedm_vasprintf failed for config line_write_value: Unknown value type: %ddm_pool_begin_object failed for config lineWARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueFailed to allocate type value._create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion faileddm_task_create: malloc(%zu) failed%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGET%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%s%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uKernel not configured for semaphores (System V IPC). Not using udev synchronization code.Udev is not running. Not using udev synchronization code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notification semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %scookie dec: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %scookie dec: semid %d: semop failed for cookie 0x%x: incorrect semaphore statecookie dec: semid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented.Udev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdcookie create: semid %d: semctl failed: %scookie create: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented to %dcookie inc: semid %d: semop failed for cookie 0x%x: %sCould not set notification semaphore identified by cookie value %u (0x%x)cookie inc: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented.Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Deactivation dm_task creation failed for %sThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %sFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u).WARNING: sysfs_path dm_snprintf failed.Failed to mangle device uuid "%s".Device uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedFailed to allocate config pool.Failed to allocate config tree.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sCannot clone NULL config node.dtree uuid hash creation failedMatched uuid %s %s in deptree.Matched uuid %s %s (missing suffix -%s) in deptree.Matched uuid %s %s (missing prefix) in deptree.Not matched uuid %s in deptree.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %s_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Suspend dm_task creation failed for %sSuspended device counter increased to %dExpected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.Failed to process message "%s".Node %s must have only one segment.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Failed to allocate thin message.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Sent messages to thin-pool %s and skipping suspend of its children.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Failed to duplicate token.Failed to clone config value.%f0%lo%s}[%s,%sFailed to read int token.Failed to read float token.dtree link allocation failedname pool_strdup failedFailed to build sysfs_path.%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %u [trust_udev] [verify_udev]%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sProcessingFailed to build size in kB.BLKRASETSkipping SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRYRemoving %s (%u:%u)\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s%*u %*u %u:%u %4096s %4096s%sfs%sfs/%s/%sconfig_outputFailed to allocate valuetruefalseFailed to clone config node.dtree hash creation failedFailed to allocate dtree.Resuming %s (%u:%u). with device flushSuspending %s (%u:%u)%s%s with filesystem syncno targetNode %s is missing a segment.Dropping callback for %s.Reverting %s.Unable to deactivate %s.Node %s has segment type %s.Unsupported message type %d.Couldn't find area uuid %s. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapUnable to suspend %s (%u:%u)is used by another devicecontains a filesystem in useDevice %s (%u:%u) %s.afffffff4ffff=fffffffffffffffffffffffffffffIfUffffffffffffffffffffffffffffff |Bp4@LX|(d kjjjiDk/proc/self/mountinfodevice_mapper/libdm-file.cSpecialstring listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%stype-specificfield-specific=~All fields must match&&Selection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %s": [%-*.*s\Creating directory "%s"Unsupported selection typeUnrecognised field: %.*sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Incorrect date format.Specified hours out of range.Incorrect time format.report selectionExpecting logical operatorspecial_dm_report_init: malloc failed||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end!~!=>=<=sinceuntilExisting path %s is not a directory.-------------------------------------------------------------------------------Internal error: Field type undefined.dm_report: field not match: %sdm_report: struct field_properties allocation failed_add_item_to_string_list: memory allocation failed for string list itemInternal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occurred while processing %s reserved value handler for field %sMatching regular expression. [regex] field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:dm_report: Unable to extend output linedm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() failedFailed to duplicate directory name.%s failed to allocate sort value structure%s failed to allocate report string structure%s failed to allocate temporary array for processing%s failed to allocate array of items inside sort value structuredm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large._compare_selection_field: field without value :%dInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_string_list: unknown list typeInternal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _compare_selection_field: unknown field type for field %sdm_report_enable_compact_output: dm report handler is NULL.dm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: sort array allocation faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: Unable to terminate output lineInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: no data assigned to field %s_do_report_object: report function failed for field %s_do_report_object: struct dm_report_field allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct row allocation failedUnrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sFailed to parse regex value for selection field %s.Operator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to parse string value for selection field %s._tok_value_string_list: memory allocation failed for selection listInvalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Internal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayFailed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s.Specified minutes out of range.Specified seconds out of range.Full date specification needed.Failed to parse time value for selection field %s.Internal error: Forbidden NULL custom detected.Unable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sInternal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actiondm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: unknown type of selection field %sdm_report: struct field_selection_value allocation failed for selection field %sdm_report: struct selection_node allocation faileddm_report: dm_pool_strndup for value of selection field %sdm_report: struct field_selection allocation failed for selection field %sRegular expression expected for selection field %s_tok_value_time: dm_pool_strndup failedtok_value_time: dm_pool_strndup failedMissing list end for selection field %sFailed to allocate report selection structure.dm_report: Missing sort field namedm_report: Ignoring duplicate sort field: %s.dm_report: Unrecognised field: %.*sInternal error: dm_report_init: definition of report types given contains reserved identifierdm_report_init: allocation of memory pool failed_canonicalize_field_ids: dm_pool_alloc failedInternal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedInternal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selection_canonicalize_field_dup: dm_pool_alloc failed.dm_report: unable to add more than one report to current report groupdm_report: can't use unnamed object at top level of JSON outputdm_report: failed to duplicate json item namedm_report: dm_report_group_push: group item allocation faileddm_report: dm_report_group_pop: group has no itemsSet if item passes selection criteria.Not matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]}^))9Failed to parse string list value for selection field %s.Field selection value %s out of supported range for field %s.Use 'help' for selection to get more help.Selection syntax error at '%s'.Syntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'_display_selection_help: dm_pool_grow_object failed_report_field_string_list: <`?Y@.AWARNING: Unknown mirror health status char: %cOut of memory. Requested %zu bytes.(rx->type != OR) || (rx->left && rx->right)Failed to parse invalid thin params.Failed to parse thin pool params: %s.build_dm_name: Allocation failed for %zu for %s %s %s.no memory for size display bufferInternal error: Inconsistent units: %c and %c.device_mapper/regex/parse_rx.cInternal error: pool_free asked to free pointer not in poolFailed to parse invalid snapshot params.Failed to parse snapshot params: %s.Failed to allocate snapshot status structure. <#devices> and and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to allocate thin_pool status structure.Failed to parse thin params: %s.Failed to allocate thin status structure.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.Failed to alloc mem pool to parse mirror status.missing ')' in regular expressionRegex charset allocation failedInternal error: Unknown calc node typedevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.Couldn't create memory pool %s (size %zu)./base/data-struct/radix-tree-adaptive.cFailed to allocate command contextFailed to allocate line buffer.LVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedInternal error: Failed to parse command definitions.Volume group %s has active volume: %s.device_mapper/mm/pool-fast.ccouldn't get token for '%s'couldn't parse '%s'device_mapper/regex/matcher.cErrorFail%lu %lu/%lu %lu/%lu%nout_of_data_spacero Failed to duplicate lvm name.device_mapper/libdm-string.cMissing lvm name for split.0%s%s%.*f%s%lu/%lu %luInvalidMerge failedOverflow<#devs> %lu/%luwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s ro needs_checkAllocation of devs failed.%u:%u %nAllocation of logs failed.userspaceBadly formed 'or' expression(.*(%s)%c)Parse error in regexCouldn't parse regexdevice_mapper/regex/ttree.cRegex optimisation errorout of memoryoperating modeindex statecompression stateused blockstotal blockstoo many tokenscouldn't get token for deviceioctlfstatbase/data-struct/hash.chead1->nn4 != NULLn16 != NULLn48 != NULLsetlocale failedsetvbuf/etc/lvmLVM_RUN_BY_DMEVENTDpending_deleteNo devices found. 0.<\| LL<,L LH:h9;:h9@@@@@ A S4STStS|TTUR\\t]]^^4_]EaEaLadaaaDb,a_degrade_to_n48_degrade_to_n16_degrade_to_n4dm_list_splicedmvdo001errorclosedopeningclosingofflineonlineunknownonlineofflinerecoveringread-onlynormal_fill_table Exabyte EBE Petabyte PBP Terabyte TBT Gigabyte GBG Megabyte MBM Kilobyte KBK Byte BB Exbibyte EiBe Pebibyte PiBp Tebibyte TiBt Gibibyte GiBg Mebibyte MiBm Kibibyte KiBk Byte Bb Exabyte EBE Petabyte PBP Terabyte TBT Gigabyte GBG Megabyte MBM Kilobyte kBK Byte B B Units UnU Sectors SeS0000000000000000Cignore lookup file line %sonline_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompletelabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uNo lvm label found on device.No mda1 offset found.No mda2 offset found.File already exists.CHECK: second mda not foundInvalid metadata file.Reading labels for pvidmda_header.magicCHECK: no mem for printing %s wrappedprecommitPVSFFRSpecified %%%s is unknown.Size is too big (>=16EiB).Can't parse size argument.is only available with poolsis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.No conversion is requested.position%s device number not changed.Cannot deactivate %s.%s: reactivation failed.WARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.pvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Ignore PV %s with VG system id %s with our system id %sCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationMetadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.WARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Scanning failed to get devices.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %llumda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizePercentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambiguous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsMinor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.lv_is_lockedlv_is_partiallv_is_virtuallv_is_merginglv_is_merging_originlv_is_convertinglv_is_external_originlv_is_virtual_originlv_is_not_synced lv_is_pending_delete lv_is_error_when_full lv_is_pvmove lv_is_removed lv_is_vg_writablelv_is_writablelv_is_thinpool_datalv_is_thinpool_metadatalv_is_cachepool_datalv_is_cachepool_metadatalv_is_mirror_imagelv_is_mirror_loglv_is_raid_imagelv_is_raid_metadatalv_is_originlv_is_thick_originlv_is_thick_snapshotlv_is_thin_originlv_is_thin_snapshotlv_is_errorlv_is_zerolv_is_cache_originlv_is_cow lv_is_merging_cow!lv_is_cow_covering_origin"lv_is_visible#lv_is_historical$lv_is_raid_with_tracking%lv_is_raid_with_integrity&dkmgtpebs`Crequest = %sOO_ALL:DESC:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:lv_is_Cannot find command %s.Failed to duplicate name %s.Failed to duplicate line %s.OO_ALLLvmlockd is not in use.Lvmlockd is not connected.busy_vg%s: field name too long.Missing end quote.Failed to create path %s%s/%s%s/%u/fd/%ufputsfflushFailed to add sublv %s.raid5_nimagesrebuildExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Post callout function failed.lvs list alloc failed.Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.%s_imetacrc32cLV update and reload failedFailed to add integrity.pipePiping:%sSTDOUT/dev/nullpipe[0]pipe[1]lockd query LV %s/%squery_lock_lv by historical LVCreating logical volume %ssnapshot%dCan't move snapshot segment.sigfillsetcmd = %smode = %slvmlockd %s %s result %d %xlockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dParsing command defs: too many rules for cmd, increase CMD_MAX_RULES.Parsing command defs: too many cmd_rule options for cmd, increase MAX_RULE_OPTS.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s.Creating lvmlock LV for sanlock with size %um %llub %u extentsFailed to create sanlock lv %s in vg %s%s: lock type %s lvmlockd result %ddm_tree_node_add_null_area() called on an unsupported segment typeTest mode: Skipping creation of provisioned thin pool metadata.Cannot create temporary file to prepare metadata. Preparing thin-pool metadata with thin volume mapping: %sLV %s has to be of type raid4 or raid5_n to allow for this conversion.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: Bad type provided to %s.Extracting image component %s from %s.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.pv->vg_name allocation failed for '%s'Rounding size to boundary between physical extents: %s.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremental size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Integrity can only be added to top level raid LV.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Cannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Adding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Failed to generate unique name for unused logical volume.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Failed to generate new unique name for unused LV %sLock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Couldn't allocate new %s segment.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Internal error: Cache mode is not determined.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.lvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.VG %s lock skipped: orphan lock needs to be adopted.VG %s lock failed: orphan lock needs to be adopted.VG %s lock skipped: adopt found no orphan.VG %s lock failed: adopt found no orphan.VG %s lock skipped: adopt found other mode.VG %s lock failed: adopt found other mode.Duplicate sanlock global lock in VG %s_extract_image_component_error_seg_busy_vgOO_ALL: --commandprofile String, --config String, --debug,--driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet,--verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal StringOO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign,--headings HeadingsType --ignorelockingfailure, --logonly,--nameprefixes, --noheadings, --nosuffix,--options String, --readonly, --reportformat ReportFmt, --rows,--select String, --separator String, --shared, --sort String,--unbuffered, --units Units, --unquotedOO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced,--ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String,--sinceversion String, --showdeprecated, --showunsupported, --validate, --valuesonly,--withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces,--unconfigured, --withversionsOO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select StringOO_LVCHANGE_META: --addtag Tag, --deltag Tag,--alloc Alloc, --contiguous Bool,--compression Bool, --deduplication Bool,--detachprofile, --metadataprofile String, --profile String,--permission Permission, --readahead Readahead, --setactivationskip Bool,--setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool,--cachemode CacheMode, --cachepolicy String, --cachesettings String,--minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--vdosettings String, --integritysettings String,--writebehind Number, --writemostly WriteMostlyPV, --persistent nlvchange OO_LVCHANGE_META VG|LV|Tag|Select ...OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_propertiesDESC: Change a general LV attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_imageRULE: all and lv_is_vg_writableRULE: --contiguous not --allocRULE: --profile not --detachprofileRULE: --metadataprofile not --detachprofileRULE: --minrecoveryrate --maxrecoveryrate and LV_raidRULE: --writebehind --writemostly and LV_raid1RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecacheRULE: --errorwhenfull --discards --zero and LV_thinpoolRULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpoolRULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_originRULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partiallvchange --resync VG|LV_raid_mirror|Tag|Select ...OO: --activate Active, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_resyncDESC: Resynchronize a mirror or raid LV.DESC: Use to reset 'R' attribute on a not initially synchronized LV.RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrityRULE: all not LV_raid0lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_syncactionDESC: Resynchronize or check a raid LV.RULE: all not LV_raid0lvchange --rebuild PV VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_rebuildDESC: Reconstruct data on specific PVs of a raid LV.RULE: all not LV_raid0lvchange --activate Active VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool,--ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_activateDESC: Activate or deactivate an LV.lvchange --refresh VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_refreshDESC: Reactivate an LV using the latest metadata.lvchange --monitor Bool VG|LV|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_monitorDESC: Start or stop monitoring an LV from dmeventd.RULE: all not lv_is_pvmovelvchange --poll Bool VG|LV|Tag|Select ...OO: --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_pollDESC: Start or stop processing an LV conversion.lvchange --persistent y --minor Number LVOO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_persistentDESC: Make the minor device number persistent for an LV.RULE: all not LV_thinpool LV_cachepool LV_vdopoolOO_LVCONVERT_POOL: --chunksize SizeKB, --poolmetadata LV,--poolmetadatasize SizeMB, --poolmetadataspare Bool, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat,--cachemode CacheMode, --cachepolicy String,--cachesettings String, --zero BoolOO_LVCONVERT_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCONVERT_VDO_POOL: OO_LVCONVERT_VDO, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool,OO_LVCONVERT_VDO, OO_LVCONVERT_POOLOO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsynclvconvert --type linear LVOO: OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to linear.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type striped LVOO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to striped.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type mirror LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to type mirror (also see type raid1),RULE: all not lv_is_locked lv_is_pvmovelvconvert --type raid LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid or change raid layoutDESC: (a specific raid level must be used, e.g. raid1).RULE: all not lv_is_locked lv_is_pvmoveRULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --intervallvconvert --mirrors SNumber LVOO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid1 or mirror, or change number of mirror images.RULE: all not lv_is_locked lv_is_pvmovelvconvert --stripes_long Number LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKBOP: PV ...ID: lvconvert_raid_typesDESC: Convert raid LV to change number of stripe images.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --stripesize SizeKB LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSizeID: lvconvert_raid_typesDESC: Convert raid LV to change the stripe size.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --regionsize RegionSize LV_raidOO: OO_LVCONVERTID: lvconvert_change_region_sizeDESC: Change the region size of an LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0FLAGS: SECONDARY_SYNTAXlvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 or mirror LV and use them to create a new LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --splitmirrors Number --trackchanges LV_raid1_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 LV and track changes to origin for later merge.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --mergemirrors LV_linear_raid|VG|Tag ...OO: OO_LVCONVERTID: lvconvert_merge_mirror_imagesDESC: Merge LV images that were split from a raid1 LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integritylvconvert --mirrorlog MirrorLog LV_mirrorOO: OO_LVCONVERTOP: PV ...ID: lvconvert_change_mirrorlogDESC: Change the type of mirror log used by a mirror LV.RULE: all not lv_is_locked lv_is_pvmoveFLAGS: SECONDARY_SYNTAXlvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --thin, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV, converts the LV to type cache.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longFLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_to_writecacheDESC: Attach a writecache to an LV, converts the LV to type writecache.RULE: all and lv_is_visiblelvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpoolOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visiblelvconvert --cache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXlvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings StringID: lvconvert_to_writecache_with_deviceDESC: Add a writecache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKBID: lvconvert_to_cache_with_deviceDESC: Add a cache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpoolDESC: Convert LV to type thin-pool.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thinpool LV_linear_striped_raid_cache_writecache_vdo_error_zero_thinpoolOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpool_or_swap_metadataDESC: Convert LV to type thin-pool (variant, use --type thin-pool).DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longAUTOTYPE: thin-poollvconvert --type cache-pool LV_linear_striped_raid_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepoolDESC: Convert LV to type cache-pool.RULE: --poolmetadata not --readahead --stripesize --stripes_longRULE: all not lv_is_raid_with_integritylvconvert --cachepool LV_linear_striped_raid_cachepool_error_zeroOO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepool_or_swap_metadataDESC: Convert LV to type cache-pool (variant, use --type cache-pool).DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type vdo-pool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopoolDESC: Convert LV to type vdopool.RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integritylvconvert --vdopool LV_linear_striped_raid_cacheOO: OO_LVCONVERT_VDO_POOL, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB,ID: lvconvert_to_vdopool_paramDESC: Convert LV to type vdopool.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrityFLAGS: SECONDARY_SYNTAXAUTOTYPE: vdo-poollvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_keep_cacheDESC: Detach a cache from an LV.lvconvert --uncache LV_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_remove_cacheDESC: Detach and delete a cache from an LV.FLAGS: SECONDARY_SYNTAXlvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepoolOO: --chunksize SizeKB, OO_LVCONVERTID: lvconvert_swap_pool_metadataDESC: Swap metadata LV in a thin pool or cache pool (for repair only).FLAGS: SECONDARY_SYNTAXlvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_mergeDESC: Merge LV that was split from a mirror (variant, use --mergemirrors).DESC: Merge thin LV into its origin LV (variant, use --mergethin).DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot).RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --mergethin LV_thin ...OO: OO_LVCONVERTID: lvconvert_merge_thinDESC: Merge thin LV into its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --mergesnapshot LV_snapshot ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_merge_snapshotDESC: Merge COW snapshot LV into its origin.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --splitsnapshot LV_snapshotOO: OO_LVCONVERTID: lvconvert_split_cow_snapshotDESC: Separate a COW snapshot from its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --type snapshot LV LV_linear_stripedOO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visiblelvconvert --snapshot LV LV_linear_stripedOO: --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXAUTOTYPE: snapshotlvconvert --repair LV_cache_cachepool_mirror_raid_thinpoolOO: --usepolicies, --interval Number, --setactivationskip Bool, --poolmetadataspare Bool, OO_LVCONVERTOP: PV ...ID: lvconvert_repairDESC: Replace failed PVs in a raid or mirror LV.DESC: Repair a thin pool.DESC: Repair a cache pool.RULE: all not lv_is_locked lv_is_pvmoveRULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpoolRULE: --setactivationskip and LV_cache LV_cachepool LV_thinpoollvconvert --replace PV LV_raidOO: OO_LVCONVERTOP: PV ...ID: lvconvert_replace_pvDESC: Replace specific PV(s) in a raid LV with another PV.RULE: all not lv_is_locked lv_is_pvmovelvconvert --startpoll LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_start_pollDESC: Poll LV to continue conversion.RULE: all and lv_is_convertinglvconvert LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_plainDESC: Poll LV to continue conversion (also see --startpoll)DESC: or waits till conversion/mirror syncing is finishedFLAGS: SECONDARY_SYNTAXlvconvert --raidintegrity Bool LV_raidOO: --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings String, OO_LVCONVERTOP: PV ...ID: lvconvert_integrityDESC: Add or remove data integrity checksums to raid images.OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active,--contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number,--metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync,--noudevsync, --permission Permission, --persistent Bool, --readahead Readahead,--reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool,--zero Bool, --setautoactivation BoolOO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String,--chunksize SizeKB, --cachemetadataformat CacheMetadataFormatOO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKBOO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool, OO_LVCREATE_VDO, OO_LVCREATE_POOLOO_LVCREATE_RAID: --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings Stringlvcreate --type error --size SizeMB VGOO: OO_LVCREATEID: lvcreate_error_volDESC: Create an LV that returns errors when used.FLAGS: SECONDARY_SYNTAXlvcreate --type zero --size SizeMB VGOO: OO_LVCREATEID: lvcreate_zero_volDESC: Create an LV that returns zeros when read.FLAGS: SECONDARY_SYNTAXlvcreate --type linear --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.FLAGS: SECONDARY_SYNTAXlvcreate --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.AUTOTYPE: linearlvcreate --type striped --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV (also see lvcreate --stripes).FLAGS: SECONDARY_SYNTAXlvcreate --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV.AUTOTYPE: stripedlvcreate --type mirror --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATEOP: PV ...ID: lvcreate_mirrorDESC: Create a mirror LV (also see --type raid1).FLAGS: SECONDARY_SYNTAXlvcreate --mirrors PNumber --size SizeMB VGOO: --stripesize SizeKB, --mirrorlog MirrorLog, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...IO: --stripes 1ID: lvcreate_mirror_or_raid1DESC: Create a raid1 or mirror LV.AUTOTYPE: raid1AUTOTYPE: mirrorlvcreate --type raid --size SizeMB VGOO: --mirrors PNumber, --stripes Number, --stripesize SizeKB,OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid LV (a specific raid level must be used, e.g. raid1).lvcreate --mirrors PNumber --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid10 LV.AUTOTYPE: raid10lvcreate --type snapshot --size SizeMB LVOO: --snapshot, --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --snapshot --size SizeMB LVOO: --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LV.AUTOTYPE: snapshotlvcreate --type snapshot --size SizeMB --virtualsize SizeMB VGOO: --snapshot, --chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshot_with_virtual_originDESC: Create a sparse COW snapshot LV of a virtual origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --type thin-pool --size SizeMB VGOO: --thinpool LV_new, --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.lvcreate --thin --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool named in --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --type cache-pool --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool.lvcreate --type cache-pool --size SizeMB --cachepool LV_new VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool named by the --cachepool argDESC: (variant, uses --cachepool in place of --name).FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool named in the first argDESC: (variant, also see --thinpool for naming pool).FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.AUTOTYPE: thinlvcreate --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in the thin pool named in the first argDESC: (also see --thinpool for naming pool.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin LV_thinOO: --thin, --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXlvcreate --thin LV_thinOO: --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --snapshot LV_thinOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.AUTOTYPE: thinlvcreate --type thin --thinpool LV_thinpool LVOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.lvcreate --snapshot --thinpool LV_thinpool LVOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a LV that returns VDO when used.lvcreate --vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --vdopool LV_new --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by the --thinpool arg.FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXlvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --size SizeMB --virtualsize SizeMB VGOO: --stripes Number, --stripesize SizeKB, --snapshot, --thin,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshotDESC: Create a thin LV, first creating a thin pool for it.DESC: Create a sparse snapshot of a virtual origin LVDESC: Chooses type thin or snapshot according toDESC: config setting sparse_segtype_default.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinAUTOTYPE: snapshotlvcreate --type cache --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepoolDESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.lvcreate --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v2DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB LV_cachepoolOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v3DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.DESC: (variant, also use --cachepool).FLAGS: SECONDARY_SYNTAXlvcreate --cache --size SizeMB LVOO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE,--stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoolDESC: When the LV arg is a cachepool, then create a new LV andDESC: attach the cachepool arg to it.DESC: (variant, use --type cache and --cachepool.)DESC: When the LV arg is not a cachepool, then create a new cachepoolDESC: and attach it to the LV arg (alternative, use lvconvert.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB --cachevol LV VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachevol_for_cacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type cache.lvcreate --type cache --size SizeMB --cachedevice PV VGOO: --stripes Number, --stripesize SizeKB,--cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachedevice_for_cacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type cache.lvcreate --type writecache --size SizeMB --cachevol LV VGOO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachevol_for_writecacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type writecache.lvcreate --type writecache --size SizeMB --cachedevice PV VGOO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachedevice_for_writecacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type writecache.lvdisplayOO: --aligned, --all, --binary, --colon, --columns,--configreport ConfigReport, --foreign, --history, --ignorelockingfailure,--logonly, --maps, --noheadings,--nosuffix, --options String, --sort String, --readonly,--segments, --select String, --separator String,--shared, --unbuffered, --units UnitsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --reportformat ReportFmtID: lvdisplay_generallvextend --size PSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_sizeDESC: Extend an LV by a specified size.lvextend LV PV ...OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvextend_pvDESC: Extend an LV by specified PV extents.lvextend --poolmetadatasize PSizeMB LV_thinpool_linearOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvextend_pool_metadataDESC: Extend a pool metadata SubLV by a specified size.lvextend --usepolicies LV_snapshot_thinpool_vdopoolOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_policyDESC: Extend an LV according to a predefined policy.lvmconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generallvmdevicesID: lvmdevices_listDESC: Print devices in the devices file.lvmdevices --checkID: lvmdevices_checkOO: --refreshDESC: Check the devices file and report incorrect values.lvmdevices --updateOO: --delnotfound, --refreshID: lvmdevices_updateDESC: Update the devices file to fix incorrect values.lvmdevices --adddev PVOO: --deviceidtype StringID: lvmdevices_editDESC: Add a device to the devices file.lvmdevices --deldev PV|StringOO: --deviceidtype StringID: lvmdevices_editDESC: Remove a device from the devices file.lvmdevices --addpvid StringOO: --deviceidtype StringID: lvmdevices_editDESC: Find the device with the given PVID and add it to the devices file.lvmdevices --delpvid StringID: lvmdevices_editDESC: Remove the devices file entry for the given PVID.lvreduce --size NSizeMB LVOO: --autobackup Bool, --force, --nofsck, --noudevsync,--reportformat ReportFmt, --resizefs, --fs String, --fsmode StringID: lvreduce_sizelvremove VG|LV|Tag|Select ...OO: --autobackup Bool, --force, --nohistory, --noudevsync,--reportformat ReportFmt, --select StringID: lvremove_generallvrename VG LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_vg_lv_lvlvrename LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_lv_lvlvresize --size SSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvresize_sizeDESC: Resize an LV by a specified size.lvresize LV PV ...OO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvresize_pvDESC: Resize an LV by specified PV extents.lvresize --poolmetadatasize PSizeMB LV_thinpoolOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvresize_pool_metadataDESC: Resize a pool metadata SubLV by a specified size.lvsOO: --history, --segments, OO_REPORTOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: lvs_generalRULE: --noheadings not --headingslvscanOO: --all, --blockdevice, --ignorelockingfailure,--readonly, --reportformat ReportFmtIO: --partial, --cache_longID: lvscan_generalOO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuidOO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag,--uuid, --metadataignore Boolpvchange --all OO_PVCHANGE_METAOO: OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_allDESC: Change properties of all PVs.pvchange OO_PVCHANGE_META PV|Select ...OO: --select String, OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_someDESC: Change properties of specified PVs.pvresize PV ...OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmtID: pvresize_generalpvck PV ...OO: --labelsector NumberID: pvck_generalDESC: Check for metadata on a devicepvck --dump DumpType PVOO: --settings String, --file String,--pvmetadatacopies MetadataCopiesPV, --labelsector NumberID: pvck_dumpDESC: Check and print LVM headers and metadata on a devicepvck --repairtype RepairType PVOO: --settings String, --file String, --labelsector NumberID: pvck_repair_typeDESC: Repair LVM headers or metadata on a devicepvck --repair --file String PVOO: --settings String, --labelsector NumberID: pvck_repairDESC: Repair LVM headers and metadata on a devicepvcreate PV ...OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB,--force, --labelsector Number, --metadatatype MetadataType,--pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB,--metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB,--reportformat ReportFmt, --restorefile String, --uuidstr String, --zero BoolID: pvcreate_generalRULE: --norestorefile not --restorefileRULE: --bootloaderareasize not --restorefilepvdisplayOO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport,--foreign, --ignorelockingfailure,--logonly, --maps, --noheadings, --nosuffix, --options String,--readonly, --reportformat ReportFmt, --select String, --separator String, --shared,--short, --sort String, --unbuffered, --units UnitsOP: PV|Tag ...IO: --ignoreskippedclusterID: pvdisplay_generalpvmove PVOO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background,--interval Number, --name LV, --noudevsync, --reportformat ReportFmtOP: PV ...ID: pvmove_oneDESC: Move PV extents.pvmoveOO: --abort, --background, --interval NumberID: pvmove_anyDESC: Continue or abort existing pvmove operations.pvremove PV ...OO: --force, --reportformat ReportFmtID: pvremove_generalpvsOO: --segments, --allpvs, OO_REPORTOP: PV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: pvs_generalRULE: --noheadings not --headingspvscanOO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup,--short, --uuid, --allpvsID: pvscan_displayDESC: Display PV information.pvscan --cache_longOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsyncOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online or offline.pvscan --cache_long --activate ayOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsync, --autoactivation StringOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online and autoactivate the VG if complete.pvscan --cache_long --listvg PVOO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput,--autoactivation StringID: pvscan_cacheDESC: Record that a PV is online and list the VG using the PV.pvscan --cache_long --listlvs PVOO: --ignorelockingfailure, --checkcomplete, --vgonlineID: pvscan_cacheDESC: Record that a PV is online and list LVs using the PV.pvscan --listlvs PVID: pvscan_cacheDESC: List LVs using the PV.pvscan --listvg PVID: pvscan_cacheDESC: List the VG using the PV.vgcfgbackupOO: --file String, --foreign, --ignorelockingfailure, --readonly,--reportformat ReportFmtOP: VG ...IO: --partialID: vgcfgbackup_generalOO_VGCFGRESTORE: --force_long, --metadatatype MetadataTypevgcfgrestore VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_vgDESC: Restore VG metadata from last backup.vgcfgrestore --file String VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_fileDESC: Restore VG metadata from specified file.vgcfgrestore --list VGOO: OO_VGCFGRESTOREID: vgcfgrestore_list_by_vgDESC: List all VG metadata backups.vgcfgrestore --list --file StringOO: OO_VGCFGRESTOREOP: VGID: vgcfgrestore_list_by_fileDESC: List one VG metadata backup file.OO_VGCHANGE: --autobackup Bool, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select String, --forceOO_VGCHANGE_META: --addtag Tag, --deltag Tag,--logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid,--pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--physicalextentsize SizeMB, --resizeable Bool,--profile String, --detachprofile, --metadataprofile String,--setautoactivation Boolvgchange OO_VGCHANGE_METAOO: --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_propertiesDESC: Change a general VG attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.vgchange --monitor BoolOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_monitorDESC: Start or stop monitoring LVs from dmeventd.vgchange --poll BoolOO: --ignorelockingfailure, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_pollDESC: Start or stop processing LV conversions.vgchange --activate ActiveOO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit,--readonly, --ignorelockingfailure, --monitor Bool, --poll Bool,--autoactivation String, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_activateDESC: Activate or deactivate LVs.vgchange --refreshOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_refreshDESC: Reactivate LVs using the latest metadata.vgchange --systemid String VG|Tag|SelectOO: --select String, --majoritypvsID: vgchange_systemidDESC: Change the system ID of a VG.vgchange --lockstartOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstartDESC: Start the lockspace of a shared VG in lvmlockd.vgchange --lockstopOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstopDESC: Stop the lockspace of a shared VG in lvmlockd.vgchange --locktype LockType VGID: vgchange_locktypeDESC: Change the lock type for a shared VG.vgckOO: --reportformat ReportFmtOP: VG|Tag ...ID: vgck_generalDESC: Read and display information about a VG.vgck --updatemetadata VGID: vgck_update_metadataDESC: Rewrite VG metadata to correct problems.vgcreate VG_new PV ...OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32,--maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType,--physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--shared, --systemid String, --locktype LockType, --setautoactivation BoolID: vgcreate_generalvgdisplayOO: --activevolumegroups, --aligned, --binary, --colon, --columns,--configreport ConfigReport, --foreign, --ignorelockingfailure,--logonly, --noheadings, --nosuffix,--options String, --readonly, --select String,--shared, --short, --separator String, --sort String, --unbuffered, --units UnitsOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --reportformat ReportFmtID: vgdisplay_generalOO_VGEXPORT: --reportformat ReportFmtvgexport VG|Tag|Select ...OO: --select String, OO_VGEXPORTID: vgexport_someDESC: Export specified VGs.vgexport --allOO: OO_VGEXPORTID: vgexport_allDESC: Export all VGs.vgextend VG PV ...OO: --autobackup Bool,--force, --zero Bool, --labelsector Number, --metadatatype MetadataType,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV,--metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--reportformat ReportFmt, --restoremissingID: vgextend_generalOO_VGIMPORT: --force, --reportformat ReportFmtvgimport VG|Tag|Select ...OO: --select String, OO_VGIMPORTID: vgimport_someDESC: Import specified VGs.vgimport --allOO: OO_VGIMPORTID: vgimport_allDESC: Import all VGs.vgimportclone PV ...OO: --basevgname VG, --import, --importdevicesID: vgimportclone_generalvgimportdevices VG|Tag|Select ...OO: --select String, --foreign, --reportformat ReportFmtID: vgimportdevices_someDESC: Add devices from specific VGs to the devices file.vgimportdevices --allOO: --foreign, --reportformat ReportFmtID: vgimportdevices_allDESC: Add devices from all accessible VGs to the devices file.vgimportdevices --rootvgOO: --auto, --reportformat ReportFmtID: vgimportdevices_rootDESC: Add devices from root VG to the devices file.vgmerge VG VGOO: --autobackup Bool, --list, --poolmetadataspare BoolID: vgmerge_generalvgmknodesOO: --ignorelockingfailure, --refresh, --reportformat ReportFmtOP: VG|LV|Tag ...ID: vgmknodes_generalOO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmtvgreduce VG PV ...OO: OO_VGREDUCEID: vgreduce_by_pvDESC: Remove a PV from a VG.vgreduce --all VGOO: OO_VGREDUCEID: vgreduce_allDESC: Remove all unused PVs from a VG.vgreduce --removemissing VGOO: --mirrorsonly, OO_VGREDUCEID: vgreduce_missingDESC: Remove all missing PVs from a VG.vgremove VG|Tag|Select ...OO: --force, --noudevsync, --reportformat ReportFmt, --select StringID: vgremove_generalvgrename VG VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_nameDESC: Rename a VG.vgrename String VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_uuidDESC: Rename a VG by specifying the VG UUID.vgsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: vgs_generalRULE: --noheadings not --headingsvgscanOO: --ignorelockingfailure, --mknodes, --notifydbus, --refresh,--reportformat ReportFmtIO: --partial, --cache_longID: vgscan_generalOO_VGSPLIT: --autobackup Bool, --poolmetadataspare BoolOO_VGSPLIT_NEW: --alloc Alloc,--maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32,--metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVGvgsplit VG VG PV ...OO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_pvDESC: Split a VG by specified PVs.vgsplit --name LV VG VGOO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_lvDESC: Split a VG by PVs in a specified LV.configOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldumpconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldevtypesOO: --aligned, --binary, --nameprefixes, --noheadings,--nosuffix, --options String, --reportformat ReportFmt, --rows,--select String, --separator String, --sort String, --unbuffered, --unquotedID: devtypes_generalfullreportOO: OO_REPORTOP: VG ...IO: --partial, --ignoreskippedcluster, --trustcacheID: fullreport_generalRULE: --noheadings not --headingslastlogOO: --reportformat ReportFmt, --select StringID: lastlog_generallvpoll --polloperation PollOp LV ...OO: --abort, --autobackup Bool, --handlemissingpvs, --interval NumberID: lvpoll_generalformatsID: formats_generalhelpOP: String ...ID: help_generalversionID: version_generalpvdataID: pvdata_generalsegtypesID: segtypes_generalsystemidID: systemid_generaltagsID: tags_generallvmchangeID: lvmchange_generallvmdiskscanOO: --lvmpartition, --readonlyID: lvmdiskscan_generallvmsadcID: lvmsadc_generallvmsarOO: --full, --stdinID: lvmsar_generalvgconvert VG ...OO: --force, --labelsector Number, --bootloaderareasize SizeMB,--metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV,--metadatasize SizeMB, --reportformat ReportFmtID: vgconvert_generalCreating directory %s.%s/block/bdiremovableslavetraceuevent%sblock/%s/%s/devclustered-userspace %u %s clustered-%s%s %u nosync block_on_error 1 handle_errors%s %s %c %d%u %u %s%s%s%s%s %s %lu %s %d %u rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d%s %d%s%s %s %s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u metadata_only pause_writeback %u meta_device:%s recalculate journal_sectors:%u interleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu allow_discardsRetrying metadata scan.Couldn't find uuid.Invalid uuid.gethostnamenohostname%s/.lvm_%s_%d_%d# Hint only%s = [%s]Failed to open crypt path %s.cryptDevice %s: %s is %lu%s.missing deviceDevice not added.No devno %u:%u in dev cache.deviceiddeviceid filter initialised.Sysfs filter initialised.mpath filter initialised.md filter allocation failedsignature filter initialised.MD filter initialised.compositeComposite filter initialised.LVM type filter initialised.%s[%d]dev_iter allocation failed.Reading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dFound PVID %s on %sAdding pvid to hash failed %sDestroy lvmcache content O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%sLeaving section (%s).Skipping: Deactivating %s.deactivatingdeactivated (reverting) pool only thin onlySkipping: Resuming %s%s%s.Resuming LV %s%s%s%s. if activeresumed origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvsfailed suspendMonitoredUnmonitored%s %s for eventsPool %s is unlocked.Pool %s is locked.Creating %sFailed to set uuid for %sLoading table for %s.Unable to resume %s. (Ignoring.)Couldn't create path for %s/%s.WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versions%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.Reading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.WARNING: bad metadata text on %s in mda%dFound metadata summary on %s at %llu size %llu for VG %sReading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Not enough space to build temporary file string.Internal error: Metadata inconsistency: Not all flags successfully exported.Could not allocate memory for string list buffer.Failed to duplicate directory path %s.No file system info from blkid for %sCannot find active LUKS dm-crypt device using %s.Checking crypt device %s on LV %s.Failed to get crypt device size %s.No file system info from blkid for dm-crypt device %s on LV %s.Failed to get crypt data offset.fs_get_info %s is mounted "%s"WARNING: Device %s: %s is %lu and is unexpectedly less than sector.Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %sThe specified --deviceidtype %s is unknown.WARNING: ignoring unknown device_id type %s.The specified --deviceidtype %s is not available for %s.WARNING: ignoring deviceidtype %s which is not available for device.Replacing device id %s old %s new %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.device_id_add %s pvid %s matches entry %p dev %sstr_list_to_str: string allocation failed.Internal error: connections must be initialized before filtersFailed to create global regex device filterFailed to create regex device filterLVM type filter allocation failedFailed to create lvm type filterdeviceid filter allocation failedFailed to create deviceid device filterNo proc filesystem found: skipping sysfs filterUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).Failed to create usable device filterNo proc filesystem found: skipping multipath filtermpath filter allocation failedPartitioned filter allocation failedFailed to create partitioned device filterFailed to create signature device filterFirmware RAID filter allocation failedFirmware RAID filter initialised.Composite filters allocation failed.Allocation of persistent filter failed.Allocation of device filter for persistent filter failed.Persistent filter initialised.Failed to create persistent device filter.Couldn't create hash table for persistent filter.Partitioned filter initialised.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.WARNING: sysfs path for %s attribute is too long.%s: Symbolic link to directory%s: Different filesystem in directoryChecking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.dev_iter values allocation failed.ignore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uignore hints: no device matches devices file entry for %signore hints: devno %u:%u does not match %u:%u for %signore hints: no devices file entry for %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: vginfos list should be emptyCannot open device %u:%u with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Leaving critical section (%s).LV %s has open %d snapshot(s), not deactivating.Deactivated volume is still %s present.Not using origin only for suspend of %s.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Checking VDO pool status for LV %s.WARNING: Failed to get uuid for dtree node %s._sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallCouldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Using udev_flags 0x%x for activation of %s._deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uInternal error: Pool %s is already unlocked.Internal error: Pool %s is already locked.Create dm_task creation failed for %sFailed to set device name for %sInternal error: Unable to get DM task info for %s.Reload dm_task creation failed for %s.Insufficient space for target parameters.Insufficient space in params[%zu] for target parameters.Target parameter size too big. Aborting.Suppressed %s identical table reload.Resume of table of extended device %s delayed.Table size changed from %lu to %lu for %s.%s ȯP8P`Ы @@@@@@@@@@@@@@@@@@@ #L$tIV2 %s %lu %u %lu %u %s %s %s read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing%s %s %d %lu %d%s%s%s%s%s%s%s %lucompression oncompression offindex-enableindex-disableParsing VDO status: %sRenaming %s (%u:%u) to %sName "%s" too longFailed to suspend %s (%u:%u) boolean array with values of type:Failed to duplicate filename.config_tree allocation failedLoading config file: %sFailed to load config file %s%H:%M:%S.%06d some losing %s resilienceCan't convert %s LV %s to %s.Adding metadata LVs to %s._extractedCan't convert %s to %s.connectSending daemon %s: helloDaemon %s returned error %dprotocoldaemon_opensanlock lvmlock LV removedseqno = description = creation_time = -- Check confirm arg %s no info.Checking %s to confirm %.32s.Incomplete rangespecificationFailed to create config node.Removed %sRenamed %s to %sSELinux context resetselabel_open failed: %ssetfscreatecon%s: mknod for %s failed: %schownCreated %sUnstackingStackingdaemon_close in VG sub %s lockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSvg_updatestart_waitLock start failedFailed to format %s device number for %s as dm target (%u,%u)Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %uExpected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sFailed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sRename dm_task creation failed for %sFailed to set name for %s rename.Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedFailed to rename %s (%u:%u) to %sFailed to build dev path for "%s".build_dm_name: Allocation failed for %zu %s %s.%s not found in config: defaulting to %dFailed to allocate config file.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.struct mda_list allocation failedInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.lockd_free_lv_after_update: unknown lock_type.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Reordering areas for raid0 -> raid10_near takeover.Updating VG metadata and reloading %s LV %s.%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.Daemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %dFailed to remove sanlock LV %s/%sskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.Check confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Badly quoted character at end of expressiondm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %ludm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %dFailed to allocate target segment area.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.Node %s was not removed by udev. Falling back to direct node removal.A non-block device file at '%s' is already presentThe node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.Unable to unlink device node for '%s'The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'selabel_lookup failed for %s: %sPreparing SELinux context for %s to %s.Resetting SELinux context to default value.%s not set up by udev: Falling back to direct node creation.Insufficient memory to stack mknod operationCould not signal waiting process using notification semaphore identified by cookie value %u (0x%x)Closing daemon socket (fd %d).Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.lockd_free_lv: unknown lock_type.lockd_result %d flags %s lm %sMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.lvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.`(hxȸзxxxxxٿxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx?x td4tdTD4$tdTtd4$nnHx`H(8_free_vgblocked_mirrors%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidunusable_thins%sblock/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtool_mlog_LV %s in not partial.%s has enough space for %s.%s_iorigraid5_lsraid6_zrraid5raid6raid10_near (same as %s%s)Failed to hash mda.Livelvfullname snprintf failedWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclose %s errno %dInterrupted initialization ofFailed to wipe signatures onInterrupted initializationFailed to initializeclose and reopen rw %s%s logical volume %s.BLKZEROOUTScan failed to open %u:%u %s.Scanning submitted %d readsScan failed to read %s.Scan failed to process %s%s: No lvm label detectedFailed to read vg %s from %sVG %s not found on %sFailed to parse %s '%s'.%sdev/block/%u:%u/slaves%sblock/%s/device/wwidscsi_debugpvids: devs: differdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filtered%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %u:%u.WARNING: Incorrect snapshot-origin table found for %u:%u.%s: Invalid %s device %s not usable.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %u:%u.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.WARNING: %s frozen raid device (%u:%u) needs inspection.%s: I/O blocked to mirror device._get_glv_str: dm_snprintf failedFailed to allocate string for new LV name.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.Internal error: New segtype is not defined.Internal error: %s logical volume %s is not a user of %s.Removing historical connection between %s and %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listNot using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dscan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedVolume %s is not active locally (volume_list activation filter?).Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.Falling back to direct zeroing.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Scanning %d devices for VG infoProcessing data from device %s %u:%u di %d.Ignoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dFound label at sector %llu on %sZero areas not allowed for segment %sMissing offset in areas array for segment %s.Bad offset in areas array for segment %s.Internal error: Cannot find pv name %s outside of _read_vg()WARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sFailed to generate backup filename (for removal).%sdev/block/%u:%u/loop/partscanSysfs path for partscan is too long.Sysfs path to check mpath components is too long.WARNING: Path %s is not a directory.Failed to create sysfs wwid path for %ssearched_devnames %s file pvids %d %u devs %d %u search pvids %d %u devs %d %udev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberWARNING: Configuration setting %s is disabled. Using default value.device is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateVG info not dropped before rescan of %sVG info not found after rescan of %sChecking transient status for LV %s.;JU (%J3JxBNBPBlQBhZBl[BkB B?CICNCHXC(bCvC@CCCLCClCCDDDD<%D/DxGD[DeDoDTyDH DD4DD|DdD`E E5EXIE$!E8F: Fh:FXDFE,FF6FG@FXHJFHTF4IFIFJF KFtKFMFLNFNF$PF4kBkGlQmU8n(VLnhd oexoXfojospxupxw8qq؃@rxrrLsȊshs،tDt(tȎtx+>h. ?4?6?7T@8@B AmDDnlDnDtEt,E8uXEX}E}EFPGhGhxHHHTIXIxJ(JHJ KDKHK LHhLL80MMMȷhNhOLOȼOOXDPP\Q8RhPRR S(8SpSxSS0TTTT(DUH VVXV WpWxWXHX(XXXY8YpZx[d[[H\\\xt\ \hd]X],^p^^,_T_h*8`3(a84Pa8ax9bAbxGTcM dhNTdHOdXOdhOdxOdOeOeTe8VeVeVeVfV$fV8fWLfW`f(Wtf8WfHWfXWfhWfxWfWfWgWgW(gWxBЉ8DhGxHI0hZ[H\x\\]l^^__`T`f8h@hThhh|jxjk8lnwLxxyԐz{P~đ~ hd8(H؄thhؔ8؍H8hȗ@hؖd(ؗHL8|ؠȣ<xĚHܚ0Hl(x؛x0XP8p(@htؿH0(|8Ȟ8$lxh0̡(hxhPXУ \l(x8 ,Llx8lX Xl88XĩXLXHH 0  ȫx L h  Xجx,HHdh8HĮX$(88LH`tįدxH(<xxȰ8,xT|x̱xx D lx!!!!в"","@h#`H$$ܳ%&D&X'((h((Դ(()h))$)8(*Lh*`*t*+̵x,, -Hh-t-H.̶/$2`23зH64(78ظ9$:p;; <\8?8@Ժ8A8B<8CpXChCxCCCԻCCCC$D88DLHD`hDtDhEE8HLHhHJJxPXQܾR$TlVYܿZ8Z,hZ@ZTZhZ|([[h\(]X^x^^^ ^4x_```(ab Xd@e(kHl(tvX|0 H4xȒPh(XȠh$XL(<Hx@,xxH h8dX(l(Dx H\8X h02@58:Hx;;HxIhLVLYh]tdDm 8olt{,8XȌȓPؓdx8ؔ ( \(p8HȚ@H8<XؼȽpx((Hd(H8xT8X8,(DXH,8,(x H , P1:pX<=8>8(???@@CFFF4hGlGhHHI,JXKLxMXW`(bc(k(nnp4p\HtvxxX(\0@px4 h   $ (@ X\ x   8 h  8 (T    p   H@ |  \8(|T"h"4(??AtBHDD08EPEpXJP`(S_xhdf8Xh(ikshxxhy({{$}x}}X~~x,(Hx`؁tȄH <Xdh(H$HX 4 x` x   x  !X !XL!l!ȗ!!h!!""\"p"Ț""$#d&&&(&( )x\))))H*4*(X**H*h*$+h+ +@,x,(,!H-) .*`.x*|.8+.+.1d/1/5/8d0=0E41HF|1G1Px2R2R3hU|3V3X4[4b4hfD5h5l5m866XP77888H9ؕx9XH;Hd==(== >d>x??<@8l@x@A4AxA B8C(#D,hF(/F0xG1G7HXXlJXJhYJxZJ[,KX]Kh]K]K]K]K(^L^@L^xLH_LbMb$Mc8M8cLMXc`MhctMxcMcMcMcMcMXf> S TXXTZ_bdxdfX8D(8``@hXHHXHLh80XhH(l(/1$2ph6<XA(ChDGTKMLPQLVxXXXx(]xa4h(j8pț$إP8X,hx,xHTHȿL8 L( `8(pX$(x  `h#Tx$$X%'|),L.X//8;X<X@xB<DHhJ|V`HWWX<ZZ8\]Tcd eT f g HkD u 8 < HH Ȍt (șd@Hxh |X$x,8@Ȱ(<ȶ$X8xxth0(x4`h8l(LH|(" " # !8%T!,!-"H6#A#B@$XC$D$hG4%Hp%HK&XL\&xM&N&(P('XT'(U'(V (VL(Z()H_)b)Xc *Xd*He*xg*zRx $PFJ w?:*3$"DL\BBB B(A0A8G 8A0A(B BBBG H` aQAA N ABD _FBAH EABH wFEB E(A0A8DP 8D0A(B BBBF |D FBE B(D0H8GpVxFdxApxHbxApF 8A0A(B BBBK  8F0A(B BBBE 0(nFIG N JGK eFBdX FNQ J(G0A8DPX\`EhKpKPL 8D0A(B BBBD h$"FBB B(A0A8G L@LC1 8A0A(B BBBH DCHCYCAC CICV WCTCMCACkCHC`FBE B(A0A8DPz 8D0A(B BBBD S 8J0D(B BBBG tXT[FEE E(D0D8G[GEBY[ 8D0A(B BBBB FKEN @CEG@` AC GHHPJXB`I@{HHPGXB`I@ 4(9FBB B(A0A8D`ShJpHxBI`p 8D0A(B BBBA lhLpPxBI`uhGpHxBI`rhNpHxBI`NhJpJxBI`bhKpMxHI`HhJpExBI`EhJpHxBI`QhDpBxBM`chGpBxGN`|hMpExBI`VhJpJxBI`tDXFBB B(D0A8DA 8D0A(B BBBE IHJBIKGBIh!9FBB B(A0D8D@X 8D0A(B BBBF DHKPIXB`I@HKPLXB`O@(6@lH4#FIB B(D0C8G`D 8D0A(B BBBF DhJpGxBI`hKp@xAS`D`pt%FGB B(D0D8DGJBIL 8D0A(B BBBF NdATL(FBA D(D@z (D ABBD DHKPIXB`I@LHjPHHA@XX)FBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPH*FBA D(D@C (D ABBC DHKPIXB`I@XL`+FBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPd,DFAD | ABF D(K0I8B@I b(J0I8B@I W ABC ` ABE p .sFBB B(D0D8DHIBI 8A0A(B BBBH MdAp 4ZFBB E(I0D8DGJBIL 8D0A(B BBBB NdA 8FGB E(A0D8DcHIBI~ 8D0A(B BBBI MbAWHJII KV 4 ;FDD n ABA ABH (FBE I(C0 (D BBBE m(D BBB| ?FBB B(A0A8D_NARFdAT 8D0A(B BBBH DJHBNh( $@FFBB B(A0A8DpxFdxApT 8D0A(B BBBH DxKDBIp AH X H D AEDDPrXM`\XCPT AAG GXH`GhBpIP@ $BFAA D`dhHpJxII`T  DABA 4< CAHD K AAF @AAHt DfFEE E(A0D8G@n 8D0A(B BBBD 4 EZ A GH ]JA I G H K ,/>HO I TC hAI A /x?Hq G x H I/?uH y G /H@H M K H0@BEB G(D0y (D BBBI S(A EBL(\0@Eg L ~H bDA0tAFBB B(A0A8Dp* 8D0A(B BBBG xNSxApUxPWxDp\xCCBZp_xWDAABIpQxIMBUpP01lDsFOJ D(A0G 0A(A BBBA PHbC1EFEE B(D0C8G`hPpThA`N 8C0A(B BBBE hLp]hA` 8A0A(B BBBE s 8C0A(B BBBA r hPpN IhKpihB`F 8A0A(B BBBA AhOpfhD`PhWpDxBBAS`MhQpNxAS`NhMpLxAQ`t2@IBBB B(A0A8G L@LC 8D0A(B BBBA WCTCOCACuCTCMCACd3LIBEB E(G0A8D@S 8A0A(B BBBI H 8C0A(B BBBD Ll3NFBA A(D0Z (D ABBG ] (A ABBE |3`OQFGB B(A0D8G 8D0A(B BBBE XBBBBRGHFSx<4@SqFEE B(A0A8DPXD`VXAPM 8A0A(B BBBF G 8C0A(B BBBE qXD`uXGPH4DT+FBB B(A0H8G 8D0A(B BBBH p5(YFBE B(D0A8JaHAm 8D0A(B BBBG HHDL\x5d^gFBB B(A0D8G 8D0A(B BBBH cNdA`5tbBBB D(D0 (A BBBD c (A BBBF p (A BBBI H<6dQBEE E(A0D8GP 8D0A(B BBBG 6gFLL B(D0D8JP 8D0A(B BBBD RXT`NhOp[PRXK``XBPXO`AhIprPMXF`cXBPd XI`PhFpL 4XF`LXHPfXO`PhOp_PIXD`XXFPh XH`EhO @ XG`Q z XG`H xXG`Hl7nFEB E(H0D8S 8D0A(B BBBF T7toFFB D(D0G`hMpUhA`x 0A(A BBBD [ hMpP L8pFBB B(A0A8FD 8F0A(B BBBI H`8,uFHE E(D0C8K`n 8D0A(B BBBK P8wFBB A(A0D@ 0D(A BBBD OHcPVHA@X9zFBA A(G0a (D ABBE  (D ABBH w8C@x8A08\9{fFAD J ABH y DBA L9|FBE I(D0A8R 8C0A(B BBBI l9t~FBB B(A0D8GAXApCUAB 8A0A(B BBBA HX:BED A(K0 (D ABBF p(D ABBD:FRA  ABA M ABH t ABA H:PFBB E(D0H8R 8A0A(B BBBD L8;FBE I(D0A8R 8D0A(B BBBD ;DL;PjFBI E(D0A8R+ 8D0A(B BBBK P;p*FLD (P0R(H X ABD _ CBD t ABI D@<LPFHD } ABF H ABE E CBF \<TFEB F(L0G8J  8D0A(B BBBF N\A\<FEB F(L0G8J  8D0A(B BBBF L\A(H=|FAM SAE C K4t=EAD C AAA e CAG X=FBA A(D0~ (F ABBI D (J ABBM e(C ABB`>Ԑ"FBB B(A0D8DP 8F0A(B BBBJ e8C0A(B BBBHl>FBB B(G0D8D` 8D0A(B BBBD ,>$EW D }l GAM E h> BBB E(A0C8D 8D0A(B BBBA N\A NJ T?H+TVLl?`FBD C(GPW (A ABBE Z (C ABBE T?FLB E(D0A8Dp\xN]xCpX 8A0A(B BBBB 8@,FBA A(G0] (A ABBD @P@|FBE A(I0G@^ 0D(A BBBA H@ȜFBB B(A0D8D` 8A0A(B BBBK 8@L{FEA A(L@S (D ABBA @AFBB A(A0D@q 0A(A BBBG 8`AFHA C(G@e (D ABBA HA@FBB E(D0D8G` 8A0A(B BBBF 4AԞFBE E(M0(A ABB@ BLFGB H(A0Np 0A(A BBBE xdB(FEJ E(A0A8GP 8G0D(E DBBF D 8C0A(B BBBH D 8F0A(B BBBE lB̠FEE D(A0X (D BBBI y8O@T8D0A (A BBBH c8T@O8A0p8O@PCmFBB B(A0A8G L@LBABMCZBBB 8D0A(B BBBG dBQC\BGBBNCOCFCKBBUCFCFCFCFCFCFCFCFCFCFCFCFC]BSBICZBABBMCFCPCKB<DDFBA A(G L! (D ABBE DhFBB B(A0A8H Q Dc 8D0A(B BBBE TMAQZA SQ KKPP,0E|FGD v ABF `EFBB E(A0D8H`hOpthB` 8D0A(B BBBI ShOpZhF`hFpKxON`h\pPxMV`hFpDxAU`hOpZhA``FT FBB B(A0A8G I B u!M A \ 8D0A(B BBBD PlFFBB B(A0A8D@bHtP[HD@m8A0A(B BBBxFDFSL B(A0A8G 8A0A(B BBBH H\Ak 8A0A(B BBBE (MYA} 8D0A(B BBBD  FV K[AbV[IaMaHBZnCx[[I[NBPFCO9FUBGJBImLTF|HoAcRIERGIIpA@vN4`vEFD  AAE J CAA 8v FBA A(DP@ (A ABBD Hv!FID D(D0i (G DBBE }(D ABB w! 4w!EP(Pw!FDD ~ DBN |w@"MEP K hwp"MEP K hw"MEP K hw"MEP K hw#MEP K hx0#MEP K h5K` I>FDD D(L0f (A ABBF D8M@c8B0g8F@P8A0D (A ABBB D (M FGKG X 8M@c8F0]8F@O L8@FBB B(A0A8G 8A0A(B BBBB HDFBJ B(D0A8Np 8D0A(B BBBD $@IEG L!v AA Lh$JFBB B(A0D8J 8D0A(B BBBD |MbFBB A(A0G I!!N!B!B!B!B!B!B!I! 0A(A BBBC D!C!e!A!D8O>FBB A(A0G I o 0A(A BBBE <PFBB A(G L! (D BBBI HQFEE E(D0D8D@f 8D0A(B BBBD L pR FBE D(D0e (D BBBD X (A BBBI 8\0SQFED A(Dp (D ABBD TTTuFEB B(A0A8DpxMcxAp` 8D0A(B BBBB <|YFBB A(G I p (A BBBF P0 ZFNI B(A0D8Dw` 8D0A(B BBBE 4[>BBA G I   DBBG @\fBAD  DBA z DBH k DBG ]gEJ A D L 8$(^FBA D(J (A ABBE 8`_FBD D(J (A ABBA HP`BBB A(D@B (G EBBC u(D BBB0`FAD J  AABA a,0aQAC DKF C D`eBBB B(A0G I  0D(B BBBH HgoBBB A(A0G I  0D(A BBBF T8m}BBB B(A0A8G L@I@p 8D0A(B BBBA PL`s BBB B(A0A8G L1 8D0A(B BBBI L~ FBB B(A0I8GC 8D0A(B BBBC E^ E S(FHG` ABI <BBB B(A0A8G L@L`Lb&bOb`bBbO bNbYbAbwbGbO R 8D0A(B BBBA NbIbHbFb[bibTbObAbrbTbObBbbGbHbAbKb@ bGbHbFbL wbCbPbAbbIbLbLbKbDHdBAA ([0U(F W ABF p ABE 0,FAG s DBI KDBDĈFAA G I >  AABF H k J ` ` FNE B(A0A8G@-HFPWHA@D 8D0A(B BBBH  HFPE `p FBI B(A0D8F`  8C0A(B BBBJ 8A0A(B BBBԉ(ԛ Л |̛BBL B(A0A8D` hOpMxJMD\`mhFpHxFFIP` 8D0A(B BBBE ܞ ؞ԞN8̊FGD A(G@ (D ABBE FBB B(A0A8G L@I@@N@g@E@S@C@p@A@\ 8D0A(B BBBA @G@H@AAK@G@B@H@FAK@y@A@H@BAS@a@Q@K@A@I@M@F@KAO@o@G@H@AAxFHA W(M0c(B [ ABJ D(P0Y(F0m(A a(P0K(D A ABK `(J0H8F@K DAB(p̥vFAL s DBD  |,FBB B(A0A8G I | 8D0A(B BBBI O I g a N J D X L a A L0_EGP AC uGHFWB GHFB (FAA ABl0FIB B(D0D8GDMHRBA 8D0A(B BBBG 4ЯvUAA uABAP tT FPJ B(H0A8JgHAEL]AbKcAJO_BLOCIRPC^ 8A0A(B BBBI ]MVBMVBLXA}]dBSKBN`BhNVB} fmFDMH NYAJYAF[ND̏3YU(E^tȽ&FBB B(D0D8Gp 8D0A(B BBBK xMYxDpXxbPxApZxN[xAp| FEE B(A0C8JT NN HTDNPYD^ 8D0A(B BBBJ .IaB^PWDqP^B$0LH@c E fHPPYHC@LXFEB B(A0D8G- 8D0A(B BBBK X`FBB L(A0A8LPz 8D0A(B BBBE 4XK`YXAP0FNA G`  DABG X8t|BFB G(D0D8D 8D0A(B BBBJ ]JVA@BHL A(D0Gp 0D(A BBBF HؒFBE B(D0D8N` 8A0A(B BBBG L$ FJB E(D0A8D 8A0A(B BBBG \tHFJB B(D0A8G 8D0A(B BBBA tLcA`ԓFBB E(A0D8NOLHIi 8D0A(B BBBK 8FJE I(A0A8G 8D0A(B BBBE MeAPMeBhIlA NN K MV K MV DUHK\@ MV D UHKJ \ BBE A(D0 (D BBBG b (D BBBD G(A EBBlpDFEB E(D0A8G 8D0A(B BBBD TjAMYA||MFBB H(D0A8J 8D0A(B BBBC MZAgMZDHcB`LQ FBB B(A0A8GHBBBADBBB] 8D0A(B BBBD DYZA YK  MR b SJ sa 0 FBB E(A0A8GRaAENIASaNIASJNIASJNIASJNIAS 8D0A(B BBBH RR`BFgBFdA,p @| FNB B(A0A8GKADDAGDDABGALGGBBGBNGBBAAGGGBLn 8A0A(B BBBF P` FIB B(A0A8GzDGAwZGBr 8A0A(B BBBH kPYBHK\AK\A8 oFGA I(DP (D ABBA l@!!FEE E(D0D8DPXe`EhFpIXI`EhBpHxGaP 8D0A(B BBBC \%QBJH A(F0GPVXF`BhBpBxBBBIPkXK`^XAPX 0D(A BBBE TXI`aXAPMXM`\XBP%4%JFDG ^ ABF GDBH,&FED D(D0 (D ABBH (D ABBLxT' FEB B(A0A8JfFDIHPiDDDAKHSNGFKPOIAPrYIDPcJbAOy 8D0A(B BBBG gPLBDAXQQHK]QKCXTVLAXWiGGBIlVDDDAKJSPJIK`wLMADFFVRANDUl NGBDHE QQEDHPp QAAJ Z^XAOgM_A_NcEBIH_(ȝ2bFHH zAI3FBB B(A0A8J 8A0A(B BBBD XKUCYNUBLWA|`6 \6X6 BBB B(A0A8G L))B)B)I)A)E*N) 8A0A(B BBBE x)J)N)B))V)W)B).)W)M)A)HEY) hBEG AB 0CFAC GPm  AABF D|CFBB B(A0A8D@8A0A(B BBB(DHPr F IXH`DhBpIP(4DEAG AAB D`EFBB B(A0A8DP8A0A(B BBBXTFSFJB A(A0G 0D(A BBBK z 0A(A BBBF XGYEy B X$GK A (@,HeFFL b DBA lpHFFBB B(A0A8GFU[KlwID^ 8A0A(B BBBE dFHD@OSDMODM'POAH(MFBB B(A0A8DP} 8A0A(B BBBG ltRFBB B(A0A8DFUEL 8D0A(B BBBE FFA4XUFAA G I   DABD dWNFBB A(A0D` 0D(A BBBD ThRpWhN` hRpK hOpWhA`HYfEDG0h 8O@I W8M@V8F0j AAD P8O@T8A0У[~FBB A(A0GHeA 0D(A BBBF DN\BM AJ LaC,T^uFAA  AWT hh_QFEE A(D0Gp 0D(A BBBE xOWxApQxRWxNpd xRJ \bt@ D 8 bBGQJ DBF DJYA H4cEN E C lcFo K f A LdFHN ` DBF I(H0^(A G ABA U(M0M(A (dRET G IH ^AA\ dFLH D(D@ (D ABBC IHIP^HA@PHIP^HA@HHNPYHB@lfWk F gTfODE m ABH k FIF U(H0^(C A ABF I(H0xgnFSI J(A0A8G 8D0A(B BBBD MXA%JDGNsHPNIKUAIKYAIN\_0IVZZS|PBW IXUJ 2LqB4|FL[ I ABG D MLK 0}QFBB B(A0A8G L@I@ 8D0A(B BBBG t@MA\@B@@DAQ@A@@DAQ@G@B@AAU@A@Y@_AI@A@R@MA]@B@ TZTzH0 HI G r F h H j F g4@܃uFIA S BBI c EBF x$FBE B(A0A8G@zHQPYHA@T 8F0A(B BBBH h 8C0A(B BBBD oHKPRXH`W@F 8A0A(B BBBE qHNPOXF`K@CHNPOXF`K@@HNPOXF`K@~HGPHXD`L%FBG E(H0D8G 8A0A(B BBBD WOTCl PQaRK WTOAЪBBB B(A0C8GPjXb`UXAPIXm``XAPNXG`XAPGX\`UXDPI 8A0A(B BBBD HXi`RXAPIXk`LXAPBXB`kXEPmXf`yXBPF8A0A(B BBBL Px,gЫ~ExDFAH K ALI O ABF B ALI 4fF_@PEDQ Y AAK ^ FAK ^ FAK @xFAG ` DBD A DBA sDBHج4EDD _ AAB p CAD i(M0\(A FAAL$FAG (N0\(A D DBK s DBG f DBD t(K  %lFJA C(G0V (A ABBI D8`@8A0B8B@h8D0N8`@u8A0F(A ABBL|FBB B(D0D8G  8D0A(B BBBF `FJab E (&FHG0 DBF LȮFBB B(D0D8GM 8D0A(B BBBK pDdFEE G(A0C8G` 8D0A(B BBBB hmpPhA`LhppLhA`BhBpfhB`.I`\ ?FBA u(L0I(A o BBI V BBF c BBI s(H0^(A  H (D A K FHd^X\FNE B(D0D8J 8A0A(B BBBB LM^A\dTFBB B(A0A8D= 8D0A(B BBBD G^DG \8DFBB B(A0A8D 8D0A(B BBBD GaA]G ^(̱0VeQ M(C0NE A LIJFBB B(A0A8J  8D0A(B BBBA HF 8hFAD f ABD Y JBC x[F̲tgBFHdFIB B(A0A8DP 8A0A(B BBBI DEP\dFBB B(D0A8L 8D0A(B BBBF CRATijFBE D(A0Dp 0A(A BBBH xHGBIp0E pP<пPHA H ABD (e0Z(A G(J0\(F D  < 1FAD GPXk`LXAPT  AABJ ( FDG  DBJ oTZT0c]BA { BBI D EBE Q BED `C C  wLdlFBD A(D0 (D ABBE \ (D ABBK (FAG0 DBG <4HFAA G0  DABI X8`@O8A08t"FEA D(G0Q (F ABBE \-FBA D(G0c (C ABBA m (A ABBE l(C ABB<sFBA A(G I  (A ABBD HPFBB E(A0D8F@ 8D0A(B BBBF ,@FDK  ABB ̷A  tFBB I(A0D8GpxKWxAp;xCIxBpQxLVxAp 8D0A(B BBBI ``FBB B(A0D8DHJJI 8D0A(B BBBD ĸ@8 @< 5PAA G0S  DABE |8G@h8A0XL FBA D(I0g (G DBBD h (D ABBG e(D ABBXsFBB E(I0D8G`N 8A0A(B BBBE X h]pHhH`? `$T8q? L`t(^p@FIB B(A0D8DPXJ`JXAP@ 8F0A(B BBBG x 8C0A(B BBBA (WBGG M DBE <1HV D(B0L\0BEE E(D0D8DPqXM`PhBpAxFFITPa 8A0A(B BBBF V 8C0A(B BBBF 4FDG h DBA W DBC X43BBB B(A0A8DPXK`DhBpIPs 8D0A(B BBBB (tAK F AE m AJ =  lNBKB B(A0C8DP 8F0A(B BBBJ jXK`^XAPF 8A0A(B BBBA l(dPBB B(A0A8DP{XO`^XAPX 8D0A(B BBBF XN`]XAP XI`U TBFA D(D`S (D ABBC GhHpJxBI`ahppEhC`L| BBB B(A0A8G L" 8A0A(B BBBA P@ BBA D(G@uHMP\HA@X (D ABBH  HKPP );@(ABAD0 DBG Tܾ}ZBB J(A0Z (F BBBA  (J BBBJ L4nFEB A(A0 (A BBBB p (F BBBD X,FBD H(G0p (A ABBG j8D@H8K0U (F ABBG pFIA D(D0p8L@^8A0F (A ABBA R (F ABBC W8I@l8F0D(A ABBdTX3FBA A(D0t (A ABBH g8M@\8A0F (A ABBC \8M@LHNPI00pBp F wH<FBB B(A0A8D` 8D0A(B BBBH <dPpFLE I(D0D8I@IHEPFXI`K@S 8D0A(B BBBG xHUPHHA@,FEG C ABH $aN A bA\ FBB A(G0[ (D BBBI  (D BBBG s(D BBB(lF] M Z F f J ltT FBB B(A0A8DpjxdPxBpx_RxBp 8D0A(B BBBD xM`xBpL)FIA D(D0U (D ABBJ e (D ABBB 4`|*FDN R LBH g CBD T+FBB B(A0A8D 8D0A(B BBBG P`BMYAMZBK[EIPFA8@3FGE B(A0t (E BBBD |5.BEE E(D0A8GOJVA2HPAD 8D0A(B BBBG n[OB\SB\SB$4DX=^ X=.FBB B(A0A8J#CNBViLBLTIBaLHBI 8D0A(B BBBA IrHHAFAPLTESjNGsPBBIMHA[KJA[kWFAwUFA^MAcZHEBBIiM\AJJF`PEEMP[IFAIDQM\ALMdAw MR PMbAXhTjAFBE B(A0K8DPh 8D0A(B BBBD QXL``XAPHHlFBB B(A0A8DP 8D0A(B BBBF @oFUB A(GXr`KXAP} (D BBBF (TxpzFBE J(D0D8GO[AuGHDBBNRKANRBKQI 8J0A(B BBBG uKJBBBBGBEQV 8D0A(B BBBD DKPBVGANINAg0 +BBB B(D0D8D`mhupYhL`ohHpGxHN`ehUpQhA`chMpDxAI`J 8D0A(B BBBH DhEpJhD`JhIpchH`zhBpGxAM`L/ `Xl FEB E(A0D8F 8D0A(B BBBF RInA2/ 8FPI A(D0T8D@R8B0f (A BBBC 8N@KHNPK0F (A BBBF  (C BBBA 8j@}8G08tXQ;FBB B(A0A8H Q G3eBm 8D0A(B BBBE IqMHP]A]IB0G\Ap[K`DeATZAI_B'N[AVqoADoFBKGHKEKAP[BSYNB@KKAKGHPAZAkLXHNXAU^B T,08XFDD n ABA I JBK \BKB B(A0D8K6 8D0A(B BBBD CMA8plBBD D(F0t (A ABBD +0H/FME E(D0A8Dp 8D0A(B BBBA L:EDL w FAE i FAH h FAA p CAA d*  |F H lp,FBB E(H0A8DPrXK`AhBpBxBIPXM`aXAPD 8D0A(B BBBF ( 0WEM F Mb MAA(8dWEM F Mb MAAd$FIB E(A0A8I 8D0A(B BBBF \UEJaE PTDBKAU)(FBE E(D0D8DH 8D0A(B BBBE K^AHqDHGBI(H8:BBE E(D0H8FPq 8D0A(B BBBB h,MFBB D(A0FppxWYxEpmxI\xAp 0D(A BBBE Ix^RxDp|FPI D(A0GXS`RXEP^XE`hXAPX 0D(A BBBD XL`]XAPr XK`M D XJ`Z L XV`V Y XI`F FEB B(A0D8J\WD 8D0A(B BBBE PH`EtGEBBBABBBNZUA` ZE (:EC M D kdc UT(FBB A(A0H8^@y8A0B8B@LHJPI0A(D BBB\?1BEB B(D0D8GmAFpFhBC 8D0A(B BBBE qIBgMG0Q[A}BADUHRAImB,jTPN[AJWB"AFA ZNA IV D IV KObBvL\BaQWAQ[AYKaB DE ANZBMJAN DQ USBXRIIp$L+FBB D(D0 (D BBBG b (D BBBD Hl/\BD A(D0yP0h(F ABB,0FBE A(A08W@GHMPO0h (A BBBH v8]@S8A08Q@RHHPO0w8X@DHKPO0u8d@L8B0O8Q@RHHPO0P8Q@RHHPO0P8Q@RHHPO08Z@V8F0]8]@T8B0t5FBB A(D0y (A BBBA o8d@Q8A0F8X@EHKPN0x8Q@SHHPK0E(A BBBth7FBD D(D0h8W@GHMPO0V8Z@a8A0M (G ABBO E8Q@RHHPO0T (A ABBG D8Z@Z8A09H9BBB E(D0D8DPS 8D0A(B BBBI 0\;FAA D@}  AABC laCN(e0MCA((>uAA MAF(,?~g(?6( )?/EAG   AAE 8)  `P)A FBA D(D0 (D ABBH ^ (G DBBK h (D ABBG 4)EFAD F DBI w DBC 4)`FFGG H DBF k DBG $*Flvd<*G,FBB B(A0A8G@OHMP\HA@D 8D0A(B BBBA  HGPeHA@8*hILEDDP AAC wXH`JhBpIP8*|JFAA } ABH { ABB +`KqFBH B(A0A8GpyxINPNp` 8D0A(B BBBJ kxXMHGBQpyxHfxAprxIfxApwxKexBpx+FIE B(A0D8J DZARIBb 8D0A(B BBBE _MYD: DH 8><FBD  BBK n DBD H?FBB H(A0D8JP 8D0A(B BBBG xh?(FNB J(I0H8J` 8D0A(B BBBK DhJpGxBI`OhfpMhB`hJpGxBI`H?ȼ BFJ E(D0D8DP 8A0A(B BBBH H0@BBE E(D0C8DPL 8A0A(B BBBA L|@PBBE B(A0A8Ji 8D0A(B BBBC (@?EAD@L AAH 0@FGG H DBF fDB,A`#@A|`TAMFBE E(I0G8DP 8C0A(B BBBF _ 8A0A(B BBBG At0A{FJN N JLN eCB0B{FJQ N JLK eCB04B{FJQ N JLK eCB4hBdFIJ u GEF bCB4BFIJ x GEK bCBdBiFBB E(D0D8Gp 8A0A(B BBBK  8A0A(B BBBG H@CFBE E(A0D8D`O 8D0A(B BBBI CFC,%CH%@Cd!ECG Q(C0J(A v AAJ KHH DPQJe A VT,D"FBI B(D0D8D@i 8A0A(B BBBF iHFPlHH@\DhFBA D(D0 (D ABBA f (D ABBA G (D ABBA dD(ERD  DAA W(g0L(G f GAA h GAH H(g0u(D P(g0[(A HLE/FBB B(A0A8G` 8D0A(B BBBA XEgFBB D(A0m (A BBBE {8L@^8C0t (C BBBC (EHg A ]R YCv G @ FEG W AD P(M0T8T@K X(M0T8P@I 4dFxEFG w AAE D FAE pF0yFAG DBN cGHFW| GHFH zNOFKn OBE DG<FDD O ABH y(N0O8F@K FABTXGqFNQ RU  AABH mROA`POAxGFBI B(H0D8DPXP`OXAPaXR`OXAPL 8C0A(B BBBH D8F0A(B BBBd,HPFBB A(A0G 0A(A BBBC TROAqNKA(Hde G PM T(T0KH\FFB B(A0A8G% 8A0A(B BBBH TOAdTPBhRPByTOAPI|FLB E(I0C8QlGQBTOA 8A0A(B BBBC TOAwNOFK}NOFM(IEDJ DAA 8$JNAD u AAF d FAA N0`JEIN K AAG kCAJWEy R F4JVFDG0\ DBE [ DBG pJFBB E(D0D8G`hbp_hH`P 8I0G(B BBBL [ 8C0A(B BBBA (`KEAJ DAA <KFKG B ABC i CBB DCB(K|EAD k AAA (K4FAD T DBK $L(FDK A(I0z (D ABBF W8M@PHTPK0r (D ABBJ S8M@THTPK0G (A ABBH e(D ABBpL<qLNT L(G0G8G@Q V BBF  LNK (M0P(A c (K0Q A LPO ALNp$MHFAA { ABJ [(T0O(B A ABD T(O0Y(A A ABG L(F0`(A AAB,MLDA Q HBD (ME{ P PF `AKpM(FPR G0\8G@GHGPQ0j  AABA d8P@S8A0%8L@V8A0\8T@P8B0I8M@X8A0hNd 9Ha G DN FBB B(A0A8G L@I@D 8D0A(B BBBE [@GA^@B@C@HAY@A@|@MAPAPAI@I@MAU@A@R@FAKAFAN@FBA D(G0t (D ABBG H(D ABB0X>ETG p FAI iCALY?FBA D(G0q (F ABBH i (C ABBG 8lY?FGH  FBI  CBD LYdAFBA D(G0q (F ABBH i (C ABBG @Y4BFEB A(A0G@ 0A(A BBBH x@ LXt FGB A(D0DPGX_`FXAPX 0A(A BBBK 4kEx C e A D%FBD D(D0E (A ABBA `8J@R8F0<hFDG W(M0T(F I ABE {FBpTBEE B(H0A8GVDiABY_D 8A0A(B BBBA 4YFBB B(D0D8G 8A0A(B BBBH \ADTL^DEPHRA+PtBPeGodPAO[VGZeFy[xA=D{FGA  ABG Z(K0^(C A ABF \ FBB A(A0D`hMpUhA`w 0A(A BBBH hMp\hF`=`hL fFBB A(A0DP3 0A(A BBBE nX\`FXAPXK`ZXDPXM`]XGP <P,0KHV B jL`FBB E(A0D8J/FWA0 8D0A(B BBBH F`BFTAJ^BFUB;>l!%FHB B(A0D8GPdGJm 8D0A(B BBBC \GYBu; PX)FDD J ABE  ABI k ABB m ABH 4*FBD k BBE RGB40<+FBD k BBE RGBTh+FLB A(A0GvcRD| 0D(A BBBE @-TFIA JrcIAe  DBBJ @8.AFIA Jr_IAe  DBBF 0HD/EKG y AAF eFA|/SHY G j/Hg A N J d0_FGB D(D0GHZBFTF^ 0A(A BBBC $x4BBB B(A0A8G I!!T!_!B!I 8D0A(B BBBG "!W!M!A!!R!Y!A!p9 BBB B(A0A8G L! 8A0A(B BBBB !V!{!A!B!A!Y!A! L< FGB B(D0D8GC 8A0A(B BBBC IKAMOBSWA_7<HHFFB D(G (A BBBK |LFHA A(D0J (D ABBI U8D@U8A0v (D ABBB Z (D ABBE (D ABBHHNFAA D08H@^8A0m  AABG V8M@c8A0 OED b AD LxPFGE B(D0L8N 8D0A(B BBBD lDRFBB B(A0A8GMYBC 8A0A(B BBBH GUAxZFBH D(D08J@\8F0A (A BBBH  (A BBBG v (J BBBJ |8J@R8F0 (F BBBG D4 0ddX^FEE A(G0q (G EBBG Z8M@\8A0G (A BBBF e(D BBBX^FBA D(D0 (D ABBF  (D ABBI X8M@X8A0D(D`~KAD b ABK D(K0^(C AABDPp|`(FBA A(GDICO (A ABBE Xb Tb PbSEMbSEM$bSEM@cSEM\`cSEMxcLJ edHHe[4\e EAG q AAH k FAF 44gEHG E AAE mCA0gs$DHhpFGD XDBlh=Ew$h]FGD EDB(hEl G M K R F L$iFGD DB$Hj]FGD EDB$,jFGD ~DBTj(hksFDD ~ ABA HXkFKA JZEB\C  DBBJ DlFKA JZEB\  DBBA D(4nFKA JZEB\  DBBA p|oYFBB B(A0D8GpxBBHCIMBACCANpX 8F0A(B BBBK ;xIOxApkxHGBIp, 8A0A(B BBBE D 8I0H(G IBBO pFFB E(D0D8F 8A0A(B BBBF BFDGFDFBB B(A0A8G I!!N![!B!A 8A0A(B BBBD G!J!\!A!_!K!_!D!K!K!^!C!W!`!I!D!a!P!O!A!@FFB H(A0D` 0A(A BBBA H FBB B(A0A8G L##D#d#B##O#d#A#z#M#_#E#e 8A0A(B BBBE D#M#m#A#^#G#L#G#F#A#I#[#N#M#K#K#G #M#R PH#FJG D(A0JJIA{ 0D(A BBBF Y 8$L$`$t$(%{HQJ NFI H r4X%eFBA H(D0D(F ABB4%eFBA H(D0D(F ABB<$%GF K \ L OI IAD A p I N R @dh']JAG f AAF  DAA ZF `('BBB B(A0E8DP 8A0A(B BBBH m 8C0A(B BBBA P)BBB B(A0D8D@} 8F0A(B BBBC ` 8F0A(B BBBA k 8C0A(B BBBI | 8C0A(B BBBH H8F0A(B BBBLd*BEE B(A0A8J 8D0A(B BBBA  ;BIB B(A0A8JGGEEEEEc 8D0A(B BBBF PFA0 AFAA D0a  AABG  |C,HcH C BGB I(A0K8G@r 8D0A(B BBBJ X$ XDBEE E(A0I8QP` 8D0A(B BBBG {XJ`iXAPl JFBD C(G0R (A ABBB U (A ABBE z (F ABBK T8M@GHBPI0H K FLB H(A0H8Gpq 8D0A(B BBBF < `MvFEE B(D0D8F@ 8F0A(B BBBI  8A0A(B BBBH HMPMXF`N@HNP[HF@H \QFIB B(A0D8D 8D0A(B BBBG H SSFLB B(A0A8DP  8D0A(B BBBA HX $TQFBE G(D0A8D@ 8D0A(B BBBI 4 8UFAA k DBG kAE4 UFDD s DBI D ABI d XVFBB E(D0D8D`N 8D0A(B BBBJ ehLp^hE`~hMp\hA`| +`\ \FBB A(D0 (I BBBI i (A BBBH q(H GGPD ^9FEA T EBI U BBG F(G0V(A HDx_zFBB B(D0D8D@ 8D0A(B BBBC X`FEB E(F0D8LPgXX`rXCP 8D0A(B BBBF xd4FAD G ABK D(a0_(A Y CBE E(P0X(D A ABC \(c0P(F n(P0k(M XhhFEE B(D0D8GPEXY`rXCPX 8D0A(B BBBG Hhl FBB B(D0D8D` 8D0A(B BBBJ L v^FBE E(D0A8K 8D0A(B BBBK L`yFFB B(A0A8G= 8A0A(B BBBH x}FFB B(A0A8DpUxCexHpa 8D0A(B BBBG nxIcxHpm xZG G xZE D,p]FBA A(D@ (A ABBG DHLP^HC@4tFAG g DBE h DBB ,&FAI  ABE PFJE A(A0G@mHLPRXA`I@k 0D(A BBBG 40,tOAD ABDH LhtFEB E(A0D8G< 8D0A(B BBBI LԉFBB B(A0A8G 8A0A(B BBBA \FBE E(A0A8G 8A0A(B BBBH HpAh4fFEB I(F0F8Q~PdBhRgALI[Bm 8D0A(B BBBK 4TIBBBB E(D0A8JRiGHEEEEM 8D0A(B BBBE TVH:LFBjLQBQJBMHLEI@ I <(|FEE A(D0D (D BBBE \h\FJE E(A0D8G 8D0A(B BBBJ D[EBIth*]̵ȵ ĵizE$`UHu C  I K E p$[FAA l(J0`(B P(Q0c(F A ABB B(L0e(A m FBG O(M0S(G AAB4FDD N FBD FB4LFCL f DBG Z DBH EX C _ A ,`BIB E(A0D8G`PhNp_hJ`GhVpdhA`LhNpehB` 8A0A(B BBBE hLp[hA`= 8A0A(B BBBA [hNpNhJ`WhGpihB`vhFpihC`ahNp]hH``pFBB B(D0A8G@ 8A0A(B BBBG  8F0A(B BBBF H` FEG A(G@lHePBXB`N@g (D BBBB XFEB B(A0D8DP 8D0A(B BBBI XN`]XDPgIu B f(dgIu B fXH@FEB A(D0D@HaPSHH@u 0D(A BBBG HaPHA@85FBG D(D` (D ABBC 4FHA m(P0_(F A ABK x@lJ FEB B(A0A8GArA 8A0A(B BBBK }RQWKajAN^AvNbA}I_BbKcBmpHAI^BKgB NO a[\Bg KO I KO j KO  IO eIDQ`AO CE @b FJE B(K0D8O  8A0A(B BBBA  I i A  Z x H I I U B  e M A  M [ A ~ h M B I h N B P R Z A L FEB E(A0D8D[ 8D0A(B BBBE phDFEA A(G0* (D ABBI C (D ABBD  (A DBBF 8_@{8A0XXD1FFB B(D0H8Ia 8D0A(B BBBE NIlJf_\KMVBM`BLWAMcAfKYAKmJ(L\HIlJIKQA C^EJO`BL[QANMUBDEmFBL K(A0Gc 0D(A BBBK l0G"FBE F(A0Gp 0D(A BBBE VxY[xGpZxN\xFpxJYxApXlNFEE B(A0D8GPF 8D0A(B BBBG |Xe`HXAPtQB FBB B(A0A8G L"( 8A0A(B BBBE "S"Z"B""F"T"A""G"t"B"^"I"L"B"]"P"\"A"X"M"^"D"X Z}FEE B(A0A8DP< 8A0A(B BBBB XI`KXAP4 ,]FAF { CBC iFB8!]FBA G L!z  ABBE 8T!^~HWd B(B0ID D DM E(B0ID,!^HiM H(B0ID K | D D!l_FED f(M0N8E@I A BBE t GBK T"D`FEG A(G0k8M@NHEPI0R (D BBBF n(D BBB`"`}FFB B(A0A8GnMYA 8D0A(B BBBC E^ABI!GTcPJ]BOPANJWBLhNBgMUBD#XvFBB E(A0A8GP' 8A0A(B BBBG TXM`_XDP 8F0A(B BBBI ] 8F0A(B BBBD DXL`YXAPI 8A0A(B BBBC p#|FBE E(A0d8M@NHEPI0O (E BBBF o (E BBBF u (E BBBH xh$}bFBH A(A0Dp 0D(A BBBG HxMsxBpBxIaxDpuxN`xApx\OxApP$؁FFB B(A0D`hWpHxBI`A 0D(B BBBI t8%$\FBB D(A08M@a8D0Q (A BBBF 8I@Y8A0 (F BBBF 8M@Y8G0% !FEB B(D0A8DnCAH^ZKAr 8D0A(B BBBE D FF }OFISd OFIB ^ OFIE MFFOR,&lEU F e K R F F|&,=FBB D(D08M@U8O@e8A0M8Z@H8D0E (A BBBF ^ (F BBBF x(F BBB0'+FBB B(A0A8G 8A0A(B BBBH |JBDbAnJNBBBIl' BIB B(A0D8D~FlARFdAx 8D0A(B BBBE 0(,Y FBB B(D0D8GfEEEDBEEEGAEBI[ 8F0A(B BBBI \lVPPCFOzIAlLHahLDJxBJFC08)XH\ D M E(B0I^ E l)FBB B(G0D8GP 8A0A(B BBBG e 8F0A(B BBBD k 8F0A(B BBBF D 8F0A(B BBBE MXM``XFP *FBB B(A0A8DPXG`cXAPg 8F0A(B BBBF d XJ`S b 8F0A(B BBBA p8F0A(B BBB`*0FEB B(D0D8I]EBSg 8A0A(B BBBG \+FBA A(D0 (F ABBF u (F ABBH k (F ABBJ L`+lBNQ F(G0D@YHZPKHA@ 0D(A BBBA \+FFB E(D0A8Dl 8F0A(B BBBI rHA,ܵfFFE E(A0D8G 8D0A(B BBBE 6KbB WL ]TBOUHO_E$,AG I n AH ,`"FFE E(A0D8G, 8D0A(B BBBE `qBBIAOWAaPOAd- FBB B(A0A8G 8A0A(B BBBB HMuA`IBJYBD-DfFAG`f ABI nhGpJxBI`ohkpFhA`0.v `DH.TFED D(D0b8\@F8A0D (A ABBJ .iFBB B(A0A8DPXXM`gXAPkXF`aXDPXF`JXBPP 8A0A(B BBBI k 8F0A(B BBBF DXF`eXAPtXF`dXAPXF`dXFP` XI`V DXF`cXBPX/dFBB B(A0A8D` 8A0A(B BBBG  8F0A(B BBBC L 8F0A(B BBBA PhKp]hC`/ `l0xFBB B(D0D8Fp-xMMEMp 8D0A(B BBBH  xPFxBpTt0FPJ J(A0H8D@HKPTHA@D8A0A(B BBBl0FFE E(A0D8DKKAt 8D0A(B BBBI >L^AD<1@FED B(m0B8B@I A BBH p GBG 1 FBB B(A0A8G L@LB/BRCQCICACICNBBcCIBBB 8D0A(B BBBE BQC_BABmBbCRBBBBRCOCMCCCICNBBCCJBBBBCCJCPCQBBOCUBABBeCIBABX2FFB A(A0DZGBI 0D(A BBBB $2lfEAC MDKx3GFBE D(G0x (D BBBF u (D BBBA D8M@KHEPI0w (A BEBE l(D BBBH3BEE B(F0A8DPi 8D0A(B BBBA T3wBBB E(A0D8DP 8D0A(B BBBG hXM`\XAP84D#FBB B(I0D8NUQBM]KA 8D0A(B BBBB  GSAyHBMXAgAXB AI GhAEcA AE p AE 85O8X5D*AAG R AAA p(N0O8F@M 85*BBD A(J0b (A ABBA 5*9ES H P45 +BEA A(D0(A ABB|(6t+BBE B(D0D8GJ 8D0A(B BBBG YM_DpSKDYNSA6-BBE B(A0A8GDP_C^ 8A0A(B BBBF HGHFHtGHFH|MMDJ\D7X0BDD I  AABI xJ`CRVNOFJ<71oDEE A(D0 (A BBBC 7%082K A  8\3K A <834P84d84 x84cHZ8l4 8h46FBB B(D0A8Gh 8D0A(B BBBC "M^BHRAOeBECFIMVDSPOLHIA KEHFK9iH9iFBI I(A0D8GP 8A0A(B BBBH 9@lK A 4:lFAG u DBG f DBD L@:lmFBB B(A0A8G 8A0A(B BBBA (:pFED r SBJ H:qFEB B(A0A8Dp 8D0A(B BBBH ,;4uKTGGIW A 08;umECP A DAB DGAl; v`;lvEv E ;vL;wjFEH A(D0[ (D BBBC l (D BBBA $<xKR S zT LAH,<@gaBB A(A08F@a8A0w (K BBBA x<xFG EA ,<y@\G  BE @ EK <zeE@ K Q<0{BBB A(A0G I  M ] F  0D(A BBBI  G H F H a G H F ` t=&FBE B(A0A8N LEHDGGGGGGGGALGBBIABAGHGApMTTYDIEFDLBIDK$TSF  8D0A(B BBBJ DIEFGLBIDKKMaBBAFFAGHAA[\FMQAHQONAINBAEIiHKBABIkGKEABIACLFRKYwWRADLFTNVNRMBJCLFTNYLGQFLILGACDTI LGACDB iKFAMDMOL`@̢FFA A(Gk (D ABBG HIA@\4T_H@;BBB B(G0C8J` 8D0A(B BBBG pAxYBBD A(Lp?xAFDHAGHIALpc (D ABBG xKbxApAd4Hk(A<EW A q A KA`bAlPA>NDB B(A0A8D8A0A(B BBBAHB[d^ XdBH@xBī)FBA A(G L@LD (A ABBA HBBAA G I \  DABI x N O F G `CdBBB B(A0A8G I Z N N C S Z 8A0A(B BBBF 4lCmBAD n ABH iAB,C8Bp F G^ YHY I 4CخzBAH A ABA fAB, D BAD [ ABK 8FIB B(H0A8DL_GXj 8A0A(B BBBF \GJEPN_ETMBnTMANOFNWTRAENOFNP I4FBE K(A0G@f 0D(A BBBG _HNPOXF`H@@tIFAA DP|  AABD   LFNF IT[H_ I \IECI K(K0_(C D AAA J(F0Q(A F AAF D (N0N D(N0p4J8FMD A(J@SHOPNHF@X (A ABBJ bHOPUHC@l HQPWHB@LHLPY U HGPE HJEGL M(K0_(A I AAE c(O0H(A FAAJFEB B(A0D8FS[L 8A0A(B BBBF KBA@NdEOrA| Uo REBBBDDDDDGBBKFDFFCBV!MXBA GT lLOBII E(D0A8FPZXF`JXFPsXI`NhGpAxBIPL 8D0A(B BBBF `xLtFBB B(D0A8D`OhKpghA`D 8D0A(B BBBH d hKpN dLaFBE A(D0J 0A(A BBBA HMdChOyADMFBB B(A0A8G L@LDb 8D0A(B BBBD DTDLDADDMDMDPDMDnDRDQDADM\ZFBB B(A0A8H Q GСءMTTMС6ءTLءAСnءOQءAС 8D0A(B BBBE yءEBEaСءMPTHС| ءOE kءLMHIСaءPMءBС\NOFBA D(J (A ABBE \OyAMdCD9BBB B(A0D8G@~ 8D0A(B BBBA H_PWHB@ZHMPqHA@LHIPmHA@Pp_@BBB B(A0A8G L@I@ 8D0A(B BBBA H_hFwBBB B(D0D8DP 8C0A(B BBBI H`G(BGB B(H0G8GPl 8D0A(B BBBD d\`LFBA A(G{ (A ABBF lGHFPd GHFE P`N FAA Q ABD P(T0L(D A ABA a(T0L(A LatO%FBB B(A0A8G 8D0A(B BBBE ha a4TP`apT.FBJ A(D0 (F BBBD q (C BBBF S (F BBBA 8bFHE E(D0D8GOFFRV 8A0A(B BBBE {LFFN\FDDBJW FDAF H |tFJD F(D@ (A ABBE U(A ABBlt-FFE H(A0D8J  M F F ]  L [ A   \ F B  _ q A M K ^ A h 8D0A(B BBBE D  K Q  F H A f B B B M  P Z B HXFJB B(A0A8L@U 8D0A(B BBBA hFBB B(G0D8GP}XM`QhOpIPFXO`PXBPBXB`bXBP^XD`GXAPYXI`]XAP 8F0A(B BBBH AXM`QhLpIPFXO`TXAPBXB`eXBPbXD`GXBPXXN`SXAPJXN`\XBPXXG`]XAPUXL`TXAPOXK`[XAP(<]EAG0L AAE d́pFBB E(A0A8L`hJp_hA`] 8D0A(B BBBD [h^pOhA`x4(FBE E(A0A8G@F 8D0A(B BBBB HNPYHB@7HQPYHA@HGPkHA@]HOP@|FAA JS_G|  DABA TȖFBB D(A0GRcA~ 0D(A BBBA TLn+FBI E(A0C8GSRLEBBBEEEEEEBBEEBBBBEBBEEEEBBELoSRLEEEEEEBEEEEEEEBBEEBBBBEBBEEELQULEIsMULEEEEBEEBBEEEEEEEBBEEBBBBEBBEEELkMULEEEEEBBBEEBBBEEBEEEEEEBBEEBBBBEBBEEELeSRLEEEEEBBBBEEEEEEEBBEEBBBBEBBEEEEBBELG 8D0A(B BBBE MUIBBIdSZHMULEEEBIXSRLI4SRLEEBEEBBEEBBEEEEBBBBEEEEEEEBBEEBBBBEBBEEELMULEBBEEEEBBBEEEEEEBBEEBBBBEBBEEEL\IbBfMULEEEBBEEEEEBEEEEEEEBBEEBBBBEBBEEEL=UIBEEEEILRBULEEEILbA) OH KGaA KJ  OH O BL B\ITHTA( FIB H(D0D8DpxZsxSpxVQIIp 8D0A(B BBBF xNmxApxKBGIp4z pTJFDE B(A0A8J 8A0A(B BBBD I[BlLwAIIZArPUAQsAD1FBB D(D0o (D BBBE l (A DIBD V8V@H8C0b (A EBBE [ (D BBBC p (D BBBF DFBB B(A0D8DP8A0A(B BBBD؋TFEE B(D0H8I@h8A0A(B BBB8 FDD h ABG YCBL\BOD D  DBBG IDDGGGNFBB B(A0A8G L* 8A0A(B BBBE '*P*^*A**R*M*D*Q* *[*M*K*\**R*M*D*L*TTFHA JEmAO  AABG lFfC`0FBA A(DpcxBMPHCNpd (D ABBJ JxTaxAp4FJ[GGUb EA @HFFB D(D0O 0A(A BBBG `n\FBE A(A0d (A BBBF _ (C BBBH Z(A BBBHl D t D @$(FAG M DBG b DBH QDBhFFBB B(A0A8G L@LFFBFTFAFFGFHFAFXFcFTFMFAFJ 8D0A(B BBBD JFbFOFBF| FGFHFAFO 0t FBA L@j  DBBI HLPFEB B(D0A8G@ 8D0A(B BBBH |FIB B(A0A8D`hNpchA` 8D0A(B BBBE hMp\hB`hKpWhA`A hKpI t `8 FBB B(D0A8GJOfB J_A H]AOZBg 8A0A(B BBBA MZAM]HBspFDE E(D0A8Dp 8A0A(B BBBE QxIhxAp 8A0A(B BBBC L(rFBB B(A0D8G 8D0A(B BBBG hԒXFIB B(H0D8DPXK`MhNpMPB 8C0A(B BBBA BXM`YXAP8@FEA I(D0 (D ABBA |q <hFAG w DBE H IBM eDBHFBB B(A0D8G` 8D0A(B BBBJ 0\FBB B(A0D8G`hYpFhB`D 8D0A(B BBBH [hWpUhB` hMpQ DhFpMxTN`khFplhA` hWpS  hMpJ lД!FBB B(D0A8GPXM`jXAP 8C0A(B BBBD T 8F0A(B BBBE T@,#FBB E(A0A8D`LbANbEIIX 8D0A(B BBBA )oSFJSB`uSM`I]BhqA[ NH JWBNVAkk[A~v~AnYWAZ YB ~jNPvDBn XD6&FGE B(D0D8GM^Aj 8A0A(B BBBH 8:FBB B(A0A8G L**F*P*B**J*P*A*u 8A0A(B BBBE d*P*`*B**b*U*A**T*]*A* *I*V*A**I*ܗ}m**ppLFSB B(A0A8D`ohEpJxBGEEDBEQ`a 8D0A(B BBBB HpMFBB E(D0D8G 8D0A(B BBBG  OFJE B(A0A8D` 8D0A(B BBBH ehJpJxJGKQ`hPpLxBBBI`hMpahA`HdRzFBB B(A0A8G L@I@ 8D0A(B BBBF P@MATAIAP@^ @IATAOAB S@KA^ADAM@o@TAO@A@W@TAO@A@@FAHAHAS@m@RAHADAM@`@TAHADAI@q @HAHAHAE c@FAHAAAS@t@GATAAAS@[ @GATAHAE J @KAPAHAE a @FAKAFAE Z @HAHAHAE [@FAHAHAК\WnFBB B(A0A8DpxHBFBBAHBEVp 8D0A(B BBBA xHBBBBABBEVp<t([:FIA D(G, (A ABBC @(]HFBB A(A0D@ 0A(A BBBG 4^ FII B(D0D8LoXHhCOUFMHNAIABAIS 8D0A(B BBBG lM`A\`FBB L(A0D8J 8D0A(B BBBA |HFA\cFEB D(C08H@GHBPBXB`AhBpBxBI0 (A BBBI w (C BBBH u (C BBBJ b (C BBBA deFIB D(D0w8K@JHBPBXB`AhBpBxBI0] (D BBBF M8K@JHBPBXB`AhBpBxBI0+ (D BBBK r (D BBBD @Cg 04`gFDD N CBG LjTthFEB E(D0C8KJTAPTrCh 8D0A(B BBBD nBVASB[AdIGEs[@EUcBI@`lFMQ A(A0G 0A(A BBBH nYEs H XtğXnNFBB E(A0C8T  8D0A(B BBBG MTTJmMTTK@<0rGFBB B(D0A8GaLHAHAKAMDNAHAIAKkWWLFDBIx 8A0A(B BBBF waAHAMDHAIAK[[LcArVHHAIAK\]REBW_ EDBB  FBF B(A0A8Dp| 8D0A(B BBBA Թ?xFBB B(A0D8JMOALON^A 8D0A(B BBBE MMOALh\BZFBA A(FP (D ABBH tXN``XAPXM`]XEPnXO`KXDPwXO`IXBPȺD, FBB B(H0H8Iy 8A0A(B BBBA uAFV{MRMYLeGKIiFUA cJKIdFE xGApU]H40PEDO e FAD s CAA HPFBE D(C0b (C BBBA H(C BBBT0PFEG A(G0N8I@RHKPI0D (D ABBD i8L@b8A0XQFED A(DprxL\xDpT (A ABBD X (D ABBO xROjG A(H0KHR~FBB E(D0A8D@ 8D0A(B BBBK HT(TFAF Ln  DABB NOFKlUFBE B(D0A8J 8D0A(B BBBE NTANOJNO[B0$ZFAA Ipf  AABE DXt[ FBE B(D0A8D`8A0A(B BBBH<\SFJE B(D0D8GP 8A0A(B BBBA 8P]FAA ] HIJ G ABF d(]FBB E(D0D8G 8A0A(B BBBF \ 8M0H(G IBBK `6 FBB B(A0A8D 8D0A(B BBBC  RJ  PCH! RI RXB KV e RI MYADSE#dhjFBB B(A0A8DSNHB 8D0A(B BBBK PWEKRTAz RG &N\C RG LOIB MM I\_A@zD,$`xhHU m(A0M8F@IdxFOI E(D0A8MVOHDVzMDDhMNZD 8D0A(B BBBA {MPTQRGHFMIcBXPVArIHFHWMbARIA(~}Ep K K` OAAL` FBB B(A0A8GCF^IAC`5 8A0A(B BBBA vKYA8I0H(G IGBXTFBB A(D0z8M@]8A0 (A BBBE  (A BBBG p\FBB A(A0g (D BBBC S (D BBBC p (D BBBF Y (D BBBE d$hFBB B(A0D8DPT 8A0A(B BBBE E 8C0A(B BBBG `FEE B(D0A8H@v 8A0A(B BBBA { 8E0H(G IGBF Hl!FEE E(A0G8G@g 8A0A(B BBBA t<P"FAA  ABA v ABF H ABA o ABA  ABA o ABD HUX FJD D(D0} (A ABBA i (C ABBG l(C ABBX FJD D(D0{ (A ABBC i (C ABBG l(C ABBXlp FJD D(D0z (A ABBD i (C ABBG l(C ABBX$ FJD D(D0{ (A ABBC i (C ABBG l(C ABBH$ؘFHA D(G0s (F ABBH i(C ABBPp,OEE D(C0O (F BBBE Q(C BBBA8xFDD O ABH f CBA (ܙwFDJ o DBG H,0FEJ E(E0L8P 8D0A(B BBBJ xLFAA G L!j  AABG !G!H!F!I!0UFBB B(A0A8G L@LBs 8A0A(B BBBF BLC[BABBNC[BDBcBMCZBABBNCVBBBABNCOCFCHBXFDA G0g8P@`8A0}8I@PHJPP0^  AABD 8G@[8A0(MFBB B(A0A8G L!| 8A0A(B BBBI !G"H"F"P!d!O"R!C!J !G"H"F"E `pFBB B(A0D8Ip 8A0A(B BBBN 8M0F(G IBBh\SQA k,ED z AD [(N0Z(A @$XFBD z EBK W(I0R8O@R ABBHhԩFHE B(A0A8Dp 8A0A(B BBBI 2:pHHFEB E(D0A8D`J 8D0A(B BBBF < ܲJrK J(F0Pk F PF lDB H @`\FAA M(J0u(A G CBG CBV9 HUFKB B(A0D8G 8A0A(B BBBG ( FKD { HIO @8t&FBE E(A0O 0D(B BBBH |`FBB B(A0A8DMbB 8D0A(B BBBH pP_BNhAKaAp `KBBA A(DpD (A ABBD rxGODAHNpcxT^xApg (D ABBE (!iD!?x%UD%@[D&A'jD@'Bs !qDD'CD'D !Dp(E pD)FùD`*GFҹD*HpjD0+IpD`-J.YD@.K F.L&cDH/M5 "cD/NH deD00Ol FH2PzppcD2QpD3RF04SF4TκFF5UF6VF7W?F8X*FF@9YDF9ZYF9[rF0:\F;]F;^@F<_FP=`ĻF=aڻF?bF@c ;FFBdFEe F8Gf$DGg7 HDKhT LDLie 8MD`MjU5 Pk{bDPl Rm  @ Rn" FSo Sp Sq Tr Ts{ Q UtU Vu H vļ"xVcDVwҼ"WFXx"WFXy Xz 0 PY{B Y| p Z} `Z~ Z&d Z3? Z9 `[> &"" [D6D[X ]U ]_ FE  Fp"@ F"@ F  ˽ ʽuDϽ^ٽ F2D^*DF*DF- 9 G(_Z4D_q @ a}  F9Dab`DDKDbϾ WDcFh! 8cD?iX [pDoknYDnFo]DFDFٿDq|DHq}Dr|DrF(t) ( FuA W^Dlw} dD0y dDy F$z7"{`D{J"^dD|a"^F(}v"BcD`}"BD~ lD lDH  8lDOb {F"{lDȃ"^lD`"^F FЄ "^FH3"B FI ZDjxw uD؆ @uD0VDPxD D F3D09DVDYD E +YDh=@ 0L ؘ\ }"B m"BaD"BYD cD0xcDsD ; 8 YD G9D@ &$/ q $9D pJdKDhKDdYD YDdFpFX"D>D>D8?D?DpcD* :lDH"B|DC"B|D XD nD D@   ED @  ED @ "D F  F F Fgi F  H F  D sD ( (Dh <  D  M P `   V "9lD  j$DX s'D z  lD  {D  eD  eDX  eD   X   @   p 0 9  A X  J  ` [ d  l H x u         X       "   0"   x"  D  D  Dx  0D ! JDx Z 9D h dDx v D  Dx  D D D  H$p  WD  $  YD gq !D = IFH  ~q !FH ! p gIDzh "  # >J  $#"B %  uDp& "BuD' |D(0 p  ` 0 @ @  0 B y p? s \ Q 0 p} Y `f @ `d d e `%thin-pool@%thin Pwr: `W@;Pwq:}`W@; @ 0 P 0 @ 0 :H:=0[T V ;:N:bX`UV0;.F_sdOide@Ymdbloop~ramdiskdevice-mappermdpdasddac960nbdidaΘccissܘubdataraiddrbd(rbdXemcpowerpower2i2o_blockiseries/vdgnbd#aoe8xvdJvdiskps3diskcvirtblkmmcblkextfiomtip32xxvtmsљskdߙscmbcachenvme@zvol VxDMP(nonepbbudevbcFR[[@Rc nuz  uz @ n@' /;K[k@y@ @ @ @@00pP*p*0p@CH0 @@pP`pFF` 0@@?0PpF`0 $" P P n @ ` @ P n 0 p p Б  ` И 0 @ P  P ` p ` @ ` В ` agodJtodayJyesterdayJSundayJSunJMondayJMonJTuesdayJTueJWednesdayJWedJThursdayJThuJFridayJFriJSaturdayJSatJnoon$Kmidnight0KsecondTKsecTKsTKminutelKminlKmlKhourKhrKhKAMKPMKdayKweekKmonthKyearKyrKJanuaryLJanLFebruary LFeb LMarch,LMar,LApril8LApr8LMayDLJunePLJunPLJuly\LJul\LAugusthLAughLSeptembertLSeptLOctoberLOctLNovemberLNovLDecemberLDecLxBGGGGGGHHHH,H5HDHVHbHoH}HHHHHHHHHH II"I/I@ G C `D K `I b Pe @ 0d d d (L^((L^X((L^W((L^((L^(;` :` (L^(0UV^f^0UEx^^E;8ZRV^^ CRVe&"" CeHV^CHV0h@0Z0hCxI0h@0Z0hCxI0h@0Z0hCxI0h@0Z0hCxIUmV@Y0ZUmVCYxI?@0Z?CxIU%@0ZU%CxI*5@G0Z*5CGxIU^^@F0ZU^^CFxIU^^@E0ZU^^CExI!@D0Z!CDxIU& @[0ZU& C[xIUo @Z0ZUo CZxIV8!V@0ZV8!VCxI^8!^@0Z^8!^CxIV8!V@0ZV8!VCxI8!@0Z8!CxIU^@0ZU^CxIsUp @ 0ZsUp C xIhU@ 0ZhUC xIV@ 0ZVC xI VV@ 0Z VVC xIUUcU@0ZUUcUCxIVIe&"" eHV^HV%V@0Z%VCxIhe@0ZheCxIMU@0ZMUCxI@0ZCxIBU@0ZBUCxI@0ZCxIr C @~0Zr C C~xI@v0ZCvxI@u0ZCuxI6U@t0Z6UCtxIb L^^f8\u8vj~!@ `  p P  p ~ P Џ P ` I&}&&(&&(&`&(P&0&( &&(&&(&&(&`&(@& &(&&(&&(&&(&`&(P&0&( &&(&&(&&(&p&(`&@&(0&&(&&(&&(&p&(`&@&( &&(%%(%%(`%@%(0%%(%%(%%(%%(`%@%( %%(%%(%%(%`%(P% %(%%(%%(%`%(P% %(%%(%%(%`%(@% %(%%(%%(%%(p%@%(0%%(%%(%%(`%@%(0%%(%%(%%(%`%(P%0%( %%(%%(%%(p%P%(@% %(%%(%%(%%(%`%(P%0%( %%(%%(%%(`%P%(@% %(%%(%%(%`(%P(%`%(P%0%( %%(%%(%%(&lv_uuidLV UUID/ _lv_nameLV% }lv_full_nameLV1 }lv_pathPathP2 (~lv_dm_pathDMPath2 X~lv_parentParent1 ~ lv_layoutLayoutv _ lv_roleRolev _ lv_initial_image_syncInitImgSync ~ lv_image_syncedImgSynced@  lv_mergingMerging P lv_convertingConverting '_ lv_allocation_policyAllocPol E_ lv_allocation_lockedAllocLockp  lv_fixed_minorFixMin  lv_skip_activationSkipAct  lv_autoactivationAutoAct lv_when_fullWhenFull 0 lv_activeActive [_ lv_active_locallyActLocal X lv_active_remotelyActRemote  lv_active_exclusivelyActExclw  |lv_majorMaj\ Ѐ lv_minorMin\ @lv_read_aheadRaheadE @@lv_sizeLSizepG s_@lv_metadata_sizeMSize@q h seg_count#SegU _originOrigin3 &origin_uuidOrigin UUIDP4 @origin_sizeOSizepJ ( lv_ancestorsAncestorsP< h lv_full_ancestorsFAncestors=  lv_descendantsDescendantsP?  lv_full_descendantsFDescendants@ 0 raid_mismatch_countMismatchesb p raid_sync_actionSyncAction  raid_write_behindWBehindpV  raid_min_recovery_rateMinSyncV 8 raid_max_recovery_rateMaxSync0W x raidintegritymodeIntegModej _ raidintegrityblocksizeIntegBlkSizem _ integritymismatchesIntegMismatchesm move_pvMovePB &move_pv_uuidMove UUID@C convert_lvConvert* h&convert_lv_uuidConvert UUID. mirror_logLog' &mirror_log_uuidLog UUID0+ data_lvData ( h&data_lv_uuidData UUID, metadata_lvMeta( &metadata_lv_uuidMeta UUID, 8pool_lvPoolp) &pool_lv_uuidPool UUID- Їlv_tagsLV Tags _lv_profileLProfile0V ( lv_lockargsLLockArgs W Xlv_timeCTime r lv_time_removedRTimes  lv_hostHost` Јlv_modulesModules  lv_historicalHistorical _ writecache_block_sizeWCacheBlkSize\ ` lv_kernel_majorKMaj 0 lv_kernel_minorKMin p@lv_kernel_read_aheadKRahead\ lv_permissionsLPerms ` lv_suspendedSuspendedp +` lv_live_tableLiveTableP  lv_inactive_tableInactiveTable0  lv_device_openDevOpen C`data_percentData%`h 8snap_percentSnap%h metadata_percentMeta%h Ȋcopy_percentCpy%Sync@i sync_percentCpy%Sync@i  cache_total_blocksCacheTotalBlocks c ]` cache_used_blocksCacheUsedBlocks`c q` cache_dirty_blocksCacheDirtyBlocksc ` cache_read_hitsCacheReadHitsc ` cache_read_missesCacheReadMisses d ` cache_write_hitsCacheWriteHits`d ` cache_write_missesCacheWriteMissesd `kernel_cache_settingsKCacheSettings `kernel_cache_policyKCachePolicyS ` kernel_metadata_formatKMFmt0 lv_health_statusHealth! ` kernel_discardsKDiscards  lv_check_neededCheckNeeded  lv_merge_failedMergeFailed a lv_snapshot_invalidSnapInvalid hvdo_operating_modeVDOOperatingMode vdo_compression_stateVDOCompressionState`  vdo_index_stateVDOIndexState]  vdo_used_sizeVDOUsedSizeH  vdo_saving_percentVDOSaving%] H writecache_total_blocksWCacheTotalBlocksd /a writecache_free_blocksWCacheFreeBlocks e Ha writecache_writeback_blocksWCacheWritebackBlocks`e x writecache_errorWCacheErrorse fa lv_attrAttr0 pv_fmtFmtX a&pv_uuidPV UUIDp0 _@dev_sizeDevSizef ȍ pv_namePVpR a pv_majorMajp a pv_minorMin@ a@ pv_mda_freePMdaFreeL @ pv_mda_sizePMdaSize`M 8 pv_ext_vsnPExtVsn@U a@@pe_start1st PEE x@@pv_sizePSizeK a@@pv_freePFreee @@pv_usedUsedK @pv_attrAttr0 @ pv_allocatableAllocatable @ pv_exportedExported P@ pv_missingMissing p@ pv_pe_countPER @ pv_pe_alloc_countAllocR ȏ@pv_tagsPV Tags _@ pv_mda_count#PMdapg @ pv_mda_used_count#PMdaUseg (@@pv_ba_startBA StartE X@@pv_ba_sizeBA SizeE @ pv_in_usePInUse a@ pv_duplicateDuplicate@ @pv_device_idDeviceIDt b@ pv_device_id_typeDeviceIDTypeu vg_fmtFmtW a&vg_uuidVG UUID _vg_nameVG0Q avg_attrAttr  vg_permissionsVPermsP *b vg_extendableExtendable :b vg_exportedExported Sb vg_autoactivationAutoAct ( vg_partialPartial jb vg_allocation_policyAllocPol b vg_clusteredClustered b vg_sharedShared b@vg_sizeVSizeH P@vg_freeVFree@L xvg_sysidSYS ID   vg_systemidSystem ID  vg_lock_typeLockType  vg_lock_argsVLockArgs @vg_extent_sizeExt@D 0 vg_extent_count#ExtR  vg_free_countFreeR ` max_lvMaxLVR  max_pvMaxPVR Ȓ pv_count#PVR b vg_missing_pv_count#PV MissingT  lv_count#LVU b snap_count#SNV b (vg_seqnoSeqR ( vg_tagsVG Tags _vg_profileVProfilep p vg_mda_count#VMdaT  vg_mda_used_count#VMdaUsepT ȓ@ vg_mda_freeVMdaFreeO @ vg_mda_sizeVMdaSize0N 0 vg_mda_copies#VMdaCpsT psegtypeTypep b stripes#Str0R  data_stripes#DStr@R Д@reshape_lenRSize`^  reshape_len_leRSize@_ 8 data_copies#CpyR c data_offsetDOff` p new_data_offsetNOff_  parity_chunks#ParR Е@8stripe_sizeStripe@D @region_sizeRegion@D H@chunk_sizeChunkI  thin_count#ThinsW ЖdiscardsDiscards`  cache_metadata_formatCMFmta @ cache_modeCacheMode h zeroZero  transaction_idTransIda ȗ thin_idThIdS @seg_startStartH @ seg_start_peStart R @seg_sizeSSizePI И@seg_size_peSSizeS seg_tagsSeg Tags _ seg_pe_rangesPE Ranges  seg_le_rangesLE Ranges seg_metadata_le_rangesMetadata LE Ranges devicesDevices @ metadata_devicesMetadata Devs xseg_monitorMonitor]  cache_policyCachePolicyT  cache_settingsCacheSettings  integrity_settingsIntegSettingsn 'c vdo_compressionVDOCompression0z P vdo_deduplicationVDODeduplication0{ x vdo_minimum_io_sizeVDOMinimumIOSize @vdo_block_map_cache_sizeVDOBlockMapCacheSizeO ț vdo_block_map_era_lengthVDOBlockMapEraLengthW  vdo_use_sparse_indexVDOSparseIndex0} ;c@vdo_index_memory_sizeVDOIndexMemorySizeP @ vdo_slab_sizeVDOSlabSizePQ @ vdo_ack_threadsVDOAckThreadspX h vdo_bio_threadsVDOBioThreadsX  vdo_bio_rotationVDOBioRotationpY Vc vdo_cpu_threadsVDOCPUThreadsY  vdo_hash_zone_threadsVDOHashZoneThreadspZ  vdo_logical_threadsVDOLogicalThreadsZ  vdo_physical_threadsVDOPhysicalThreadsp[ H vdo_max_discardVDOMaxDiscard[ x@ vdo_header_sizeVDOHeaderSize`  vdo_use_metadata_hintsVDOMetadataHints0| ؝vdo_write_policyVDOWritePolicy  pvseg_startStartR 8 pvseg_sizeSSizeR lcdevtype_nameDevTypeQ h devtype_max_partitionsMaxPartsp\  devtype_descriptionDescription0Q c log_seq_numSeqR clog_typeLogType0Q clog_contextContext0Q clog_object_typeObjType0Q c log_object_nameObjName0Q c(log_object_idObjID0Q d0log_object_groupObjGrp0Q d8log_object_group_idObjGrpID0Q )d@log_messageMsg0Q Bd Hlog_errnoErrno\ Od Llog_ret_codeRetCode\ VdFcd0~ gdvdP~ zdvd`~ dvd`~ vd`~ @ddp~ dd~ d e~ d e~ ((ee~ (((e!"~ ((ڈPBp SB@Q\PB gB0 oz&0QBHBܥ@{i @ 0&` ʥ@@ ` %PB  D/G fS[qxP@_f@@l@sӥ@eBp&`P&l @ $  P* EP  *(.P!.5" "OXB#uXB $B0%gB&~& b'c(8@)X$*p+-;,&pX-.^/00g1`2$, 3@P4J05hfS06js`7&P8&9(0:---h--abort--activationmode --addtag P--adddev x--deldev--delnotfoundP--addpvid--delpvid--aligned --alloc !x --atomic  --atversion  --auto h --autoactivationP--setautoactivation8--binary--bootloaderareasize--cachep--cachemetadataformat--cachemode--cachepool--cachevol@--cachedevice --cachesizep--check--commandprofileH--compression--config --configreport+--typeconfig,H!--dataalignmentx"--dataalignmentoffset "--deduplication!8#--deltag" #--detachprofile#8$--deviceidtype$$--devices% %--devicesfile&&--discards'x(--driverloaded((--dump).*--errorwhenfull*h,--force+ P---foreign,---fs-`1--fsmode.x3--handlemissingpvs/3--headings0/4--ignoreadvanced14--ignorelocal25--ignorelockingfailure35--ignoremonitoring4%--ignoreskippedcluster5x6--ignoreunsupported67--importdevices78--journal89--labelsector9:--listlvs:8:--listvg;`:--checkcomplete<x;--lockopt=;--lockstart><--lockstop?8=--locktype@"0>--logonlyA6--longhelpBh>--majoritypvsC>--maxrecoveryrateD?--mergeE@--mergemirrorsFh@--mergesnapshotGC--mergethinHXD--mergedconfigIE--metadataignoreJF--metadataprofileKG--metadatasizeLhG--minorMG--minrecoveryrateNH--mirrorlogOJ--mirrorsonlyP(K--mknodesQK--monitorRL--nameprefixesSM--noheadingsTN--nohintsUN--nohistoryV`O--nolockingWO--norestorefileX@P--nosuffixYP--nosyncZS--notifydbus[T--noudevsync\U--originname]@V--setphysicalvolumesize^V--settings_PW--poll` Y--polloperationa'--pooldatasizebHY--pooldatavdocxY--poolmetadatadY--poolmetadatasizeeZ--poolmetadatasparefH[--profileg[--pvmetadatacopiesh%H]--raidintegrityi]--raidintegrityblocksizej^--raidintegritymodek`--readonlyl8a--refreshm`e--removemissingng--rebuildo  i--repairpi--repairtypeq-0j--replacer k--reportformats*l--restorefiletn--restoremissingu0o--resyncvp--rootvgwO--rowsxp--segmentsyq--separatorz(r--shared{pt--sinceversion|u--splitcache}v--splitmirrors~Xw--splitsnapshot0x--showdeprecatedy--showunsupportedP{--startpoll{--stripes|--swapmetadata~--syncaction)--sysinit--systemidh--thinpool`--trackchanges%--trustcacheh--type x--udevoutput--unbuffered--uncache--updateЋ--cachepolicy(--cachesettings--unconfiguredH--units--unquoted؏--usepolicies8--validatex--valuesonly--vdo0--vdopool--vdosettings--version--vgmetadatacopies$--vgonline(--withsummaryh--withcomments--withgeneralpreamble--withlocalpreamble0--withspacesx--withversions0--writebehind--writemostly(--corelog--resizable--allocation--available --raidrebuild --raidsyncaction)--raidwritemostly(--raidminrecoveryrate--raidmaxrecoveryrate--raidwritebehind--virtualoriginsize--split--metadatacopies&--activatea إ--alla--autobackupAX--activevolumegroupsA--allpvsA--backgroundb@--basevgnamen%--blockdeviceb--chunksizec--clusteredcH--colonc--columnsCh--contiguousC--debugd--exportede--physicalextentE8--filef--forcef--fullf--helph--cacheH--historyH--?H--importi--intervali--iop_versioni--stripesi--stripesizeIH--logicalvolumelH--maxlogicalvolumesl--extentsl--listl--lvmpartitionl--sizeLP--persistentM--majorj--setactivationskipkX--ignoreactivationskipK--integritysettings --mapsm --mirrorsm--metadatatypeM8--namen8--nofsckn--novolumegroupn--oldpathn--optionsop--sortO--maxphysicalvolumesp--permissionp --partialP--physicalvolumeP--quietq--readaheadr#0--resizefsr--resetR(--regionsizeR--physicalextentsizesH--snapshots--shorts--stdins0--selectSH--testt--thinT8--updatemetadata--uuidu --uuidu--uuidlistU--verbosev--volumegroupVX--virtualsizeV--wipesignaturesW--allocatablexP--resizeablex--yesy8--zeroZ---NonepBool6Number@8SNumber8PNumber7Uint32иStringиVGиLVиPV `Tag Select иActivationMode мActive 6CacheMetadataFormatPCacheMode Discards,MirrorLog ;SizeKB6SSizeKB]SizeMBpHSSizeMBZPSizeMBjNSizeMBP]RegionSize PExtentszSExtentsPExtentsNExtentsPermission pMetadataType иUnits HSegType Alloc!LockType"Readahead # 9MetadataCopiesVG$9EMetadataCopiesPV%@:unused&@PollOp'WriteMostlyPV (SyncAction ) ReportFmt *PConfigReport +ConfigType ,`RepairType -`DumpType.4HeadingsType /ConstString 0ConstNumber 12```P`P`````$H05 `$H helpHelp ?HelpsdOide@Ymdbloop~ramdiskdevice-mappermdpdasddac960nbdidaΘccissܘubdataraiddrbd(rbdXemcpowerpower2i2o_blockiseries/vdgnbd#aoe8xvdJvdiskps3diskcvirtblkmmcblkextfiomtip32xxvtmsљskdߙscmbcachenvme@zvol VxDMP(i@jVW"mlj0m SpTKpngpn#pn0s M   @ `@ ` `{@&yp,zp, `#1$$($'& ""#"!, !- ! P)%ooz}|&*0+`"3.4/nmrHIZJ[KV\@3) (( selectedSelected0 helpHelp ?Help)  "9 ! $ zf$ JB S o! d v  \ D   Н @ȸ `8 e xf P  _o = X m }       ` s%s%o8 (&G,0 o*ooo*oo(o &0`@`P```p`````````aa a0a@aPa`apaaaaaaaaabb b0b@bPb`bpbbbbbbbbbcc c0c@cPc`cpcccccccccdd d0d@dPd`dpdddddddddee e0e@ePe`epeeeeeeeeeff f0f@fPf`fpfffffffffgg g0g@gPg`gpggggggggghh h0h@hPh`hphhhhhhhhhii i0i@iPi`ipiiiiiiiiijj j0j@jPj`jpjjjjjjjjjkk k0k@kPk`kpkkkkkkkkkll l0l@lPl`lplllllllllmm m0m@mPm`mpmmmmmmmmmnn n0n@nPn`npnnnnnn/sys/@&@&P&P&`&`& &&0 LVM-/dev/mappernone SIGINTSIGTERM8&8&H&H& &((`&`&&&&&&& & &(&&&&&& & &0&0&(&`U`&&X&X&&&(&& & &0&0&@&@&P&P&(&& &(&&&&&&&&liblvm2cmd.so.2.03-2.03.28-6.el9.x86_64.debug#q7zXZִF!t/'oT]?Eh=ڊ2N%n*X(c{v="H=iuNߘt%ץ53iݙQ־XvB*ct{2}F:@AƄ_&FUmfS&1%dɽdf;B}䋚c^ކ~Dl=HQ#@FLԔvZ0& bߔ-1<>9rn&I@:lh"_`ӿdG֖xߕ"8ڈ@/\F4u>wl01+&yOi wsȽ8x[@" mY此y IJq Q%yE#oCdHVwٳaYNW?q\ ^p\8Kb'TyMk  S[@&g<AR+Ӵ9SfE4 FgL Y8!>{k HR؞:*dɗ"Pun:ToHJ{SkGoQ4BS(9⸶!_w%a0.jյ1Yz j^k)=0ӰG2w SUW6١6dҔ %Gщ!CU3'|o(q\P(rt̝K-)SOzwTFE=tߖ={B1sfK_"X;9ѵ^Kv02x`Vܳrl{)F3=rUxD||34Eu8`|)}E=_"Īܵ {">#mDzY‰i %(J%. O E6%ʲBB"eVO&b@Wk5ϵ qme֧3nyk&i{dWv\_+> yGE330$,R\3q1+ցg@2(}*ߥ찲`Dq&AZ}(}s2BsYF.Cޞ5V䧙4G WT[`Us?SH G&;BXu4n+%rUك*jJVGJKp$H^wi%?]إV_\*,dD`,SZX<>1Q[gl ;&uT'kO,佉BI[c]Jm[YVZUV}z{Rh8DwbwB~8#gϏu)cܴIv$(nz,IvvC)vPACEŨI+҆wh~&TL'svͺl\rBmmu{ 8^wiw351jՊz7+H<ֻSAY9CnضI }8j GO:~Q 5Lf<_KގV܁ !H0*9].d׿@qhG:Ma'Y:%{oS>g:B;&s^Zmz7v]\CDZXkn,8ʎR@WE  2\:.4rPW# 0k,vbIcTiX tGÝϓCHn `kb>l6 -yɛD"j&l!x»e RDf(euYqQdkYq);\`* pbĮL@+'ҝ>t':jӜ/k" \wMIޙMlEiՉ>cԶkuPX҈ <Vn +l@y>Wy[p(F<=oLDh.֡.)N* "a>cςb8s$ꄯ< jIΡb]H*2u+5gH䤅<>4g->eZkXeJ Qa|.{WnS)=<flB53ip * R,3~&!2*:Aɱ a{I$1Z/w[0UlsTxz# _0`\=5|H:o}LnBZn@UI3;a= H>CR\^?zS쳪le}RrG}alˈo9oGբ3I[քcb'K*'n 0Dr\IW,c AHܳqC4mMP_cEk $4$ }Q`*0"Dz . `iQgxq˝Q#VL`JYg q$Sy{T'ֹ}LF*# cvL+$TO/j|i(il0c2D̮N`J j5)4U?כ~ff274֠/^|äW^r6]3n+l/9gi2WJg,Lϻ'SnHC_x %m,/DMu,wL@s"nȴB_dz|h>KKNOtb^]tg By\o PqPfXݨR{*ԏbq6]'宏_,ɏZ~p˸kBj.@">])[a `ɠtnB+2um9}UzY3x5(MoPdkb,{ɍj>N]?֍rL-7pR[A`' ڒ5n ũIy1cIOI Qw|nG*]p#jJ|dk܌="yNy4:E2_v3oM=$}?{ʘ84&k?Ki ănCp^h`mZlɂ*5#pkSį30c@0._Yj:ߏWUeEtp菬%^xHxbGdBGt+F:;FV?Q3sܪ4`;)1v$7E8G%KuOSet w'I`ch3)4[M93 xb)~vpLljјKȂ8u2"M$e~sgq9N:SwO| [P d!fSɥ8 q\EvHn/.#Uӝb̧"TA >f"Cx{pAP7b$U5 4Q߅ Q)ś$Geόu o?9Vt+wΦ9.'9vdz^v32 qpldGg+ދ_jOJW;HBy,w!rm%uy֪~ B'Qv!ź^/z:9P R˹lJtU GD_&!gO^0~3?IKf~*/!:^z_|" P!>8.3wwѤAûlAc)OHLxY+ jV"_$Y:)*A=d[ Tώ]썠|Fg6C!_blδqGZb.u*FY_zƛG&)4ҌT{ Xف8c[6UPag&= *_:z80B'b/WoUs\fV4Y'EA }LP]g^Xh˪sηY J'J>MC"í3Vo~PY L4DVII\%>*e X{#4'7@8 !* FPȗX+ t3.F{nhkeLi<&ESI5QR ɖ;`iEXp$ToD&\DDiCc\D EBC TpMŘy~櫓r2DwN/ HxA.^aj C8mFyl YioEPSdcP*B)̋}u_&T߰5"/^0 edGHWotc Cm\z1Ub},rN砬_\IHͦ2{P8 !(0lEgeaJw G?a(<;2O*6~ؗw`6z.)4F췥y_[Mֵ9yȳFmۍ6z I2'F)4IM!? G_<|ᙇr'^:DxgE2chq.]||# `,răNz!d󙠚_7@.0>j +ÀiC \,$*y]eWwr^,|ۘQ K-i>҉Ho)@OiwsZL%l7Jl_5N)E /q7#Dj8\el'C|nC}_%ˡn,Nhbu3wewڦp;ddKv%B}],o baxI;~&~srE93a)#J 93^NH`jΣIp8:*Lk<#o)Cxp*nf9#An1%\:֝ {FU w׹&6ܬe3in$~]3Fyrsd0 3g?/˥Eƪ酎A")L9)tY;:! %`1F5ػIY@0ݘ#mfKGc=Z~m%0t)̱f<-f8L6 xx +h()p.`p`Rr]mpZ4Yrlk,") #D :ajzkKprk#=ѭf`ZșW4AheA&+a ɝK^KUP;g4a,|;GRbnZf( t:Ps9PqS3M=huRI[ H4p^ fdA'y=| ByxI$]穖m\[~"2-KWHGHcTAO~L}wm)@R$+̼m"L0(h8<=e._\ߘ) ?f} ȘʣrBbfxct]$w ;X t,twps g;y@*,>ȥۙ;^;*:)N0X`\:B躽MSg  `O2zţm}Ԝ6J."(ՎbKZXW< A^iWsfO{3VJ %^ Ni{'ދY𜨳LIcڠI:p2¬_(KyLT= P0T+Uǘ=}5JY/+d/ H=Ic8"7UkjZNer2#"8%E^&q(iW6?v1eJê/e}僸RU}*moߚ"c =iM*P.!6_\~nǏRhhplmk%1{')~=fjgwSj9P(7 rs= e/нm+fT~dt\e5՘7:ثwp;߿k(@ N(!phxyڶZtJRN}(1RBzid%Mma.ьhPHC%5+F~G~cۂ.fT֤\2q f̰` i+G=0{)AGԗ>#g~~_~L/f>dtg* ɛ.ˎeD?ʞeng+R$֣ЫL'=ۭ#'\$DN+;EjJFN!d\Yf e$D\$E&)0 _[- q}As`\h>EwH-."CV~<׫t5s9_ehMayh=9X0w> 02u']09B՝9LT .ȠwH*`e0uB9+l,ddΑ$w{6v\ 1JJQ)n5RJwއSH_¤mE {qtѦ1|B=h5T}aՅ ?tXOls-]LvGt2aRwhMKI뺣vksU/"UKofSLJ\^14ق`ykb×b>5ge'TNؓ jﮣ/h! lX aH333]_lɝ5遅:Z IC5g XOl֦(n_ވ ʎ U{3ڋԳqIvPͺXh-d䩠1{YD6eOk_ѹT=.7 B\=HaW̔vGH9Qwhvᝢf+Fs@9膧n -2)^katաdXΙ Hn!%]-?& `'NK;+dk@yۚ Tkwu3$#Oӻ.0{6T dc3Ϻ`^[cj)0 ZAC}㰲!׿C.> cYm}EV4+H[12l&*Broj-,ʙHNosDad,)5LJ%TBiaF$'͝ 2;;<6H.}D&v#qhRWA׃I`?~x #7=aO%N2:L^B &V:O,'fn.!Mc٘&@x4y dzQDRɕ3PFkmݷ6SX  ֹ)zt"Wȟrb٢Yz'}Z[Ie`|@K04P!/: S[3bL$RlE6*$j$E(T g5%=*502$OEeWG%^?dn1VhI, \(1h G"C zɝ$ (flEFjDG!&dgQtz9O:br.KKp9[Lpâ tO9Rh 1du#w7iQH_ />Z׳ VjA[^&7.&cݏĉo^4+`Ƌ]>Q! 6>ylW_e6e˟|&:YZN|IB<^ X>umŷiE.VNF0]IΚ>\EhH)B /aB|_sVK\"=#{[$ݶ2#K"ЩڏcNj;?cc3r2_>Y7hhp]lPqMzx\6N=hfT:sI"BӦwY *ܜW 6U܌ Dm+:=╏H>= ~[j:zbnnrZxؐ&DGX<^v=tfH'&$G.ɐ)ÅE)D 8s ʞ :Փ4\PRcdd.,z%9zF fF-DW*ʯMN-7mQ{qd#ݽ- ? 5W&>%0/9Mzcѷd bԐ<PSQK [}BU#5g3;p>` y2ksdUa B/T &gx]u~S_2EF^$7XK LQpgbûHF,>ṊxwM!v̯og@@nU+iqD fKY fcܲxzk /gu&TgںڐS*#kIuRQxJ9Yx@62kG"^w ;~Mtd)7=Upv$C& Tqcp$1 6(6D s9=65=$i{Ѣ@VT+@~RLp6_פTXTHz/BBbTm,ǯN֬ E0'ӊɑ`V?_ ׶UI4 n|/+wdFv9XƦGSW<,V}^/>gSSY=~l0񰈐OzmkAt_˖ߗY8;ZY3zH[(3V+273UҜ2<Gie]fG>0GEebͫNv:S{hBvwb=r1^ Mwr<,M}X<eBEv^) 8 :aojљvPqpK,AI U΄ކ*pJ. 0 N•ӘGy PX$aFm+B?b22-t.ROUs92?u"ߔ#O(Άͱr‹ERb#`tֺNF/IK,N2 FG2`} 9 eѣKXS1fAJlcYOm]D3Ļmܝ&[KW*_ގM>JoK؞rޝ™maȋDi޿aG 48k(> ܢm?N)5Ls!$XJg,FwOȈ  ve+fL]*U} X3_":|g9+fHCj[D$j<^4 uZ3t Qu6UuHRF8I@8%v`&6:Kt]{c !9 /ele1NN| vO>1YƉ޺gʹY$n_nG~Ea 5{5X9MYqc$_¡A5XFhH=8Vp7ҩsDv|Sox3Y.ZCtn2 2Zwx4ggvìw`"V~|Vfbh&n[=/PX|<,Thm}AZ?5U> ɑە;VFXlX㵽 [˥F,q;\>,'QB%c0IG{1fYyUv H|1>SoJΓ\:jmκeS4rDhlBK rn5G˭b**~3xG`oVDwKlFe3 d_X]M>|%x Yƺk+pcd^(wÀ@|v9/(q9[H/zgеI2g8KEUv<>Ӵ2 "WF{a׾ .;G,;[򃲬:jALv\HB0-MO"/ xn+aѐa\߀<[?c `o|yMN( 1]5gsQpJ䇵aGoY<.C]EiMlm]aB ?LZZC8%7cF \*Yf,Cb\`AHޔEs51tsRL9fSHbEA Drp-Z䗇o*N(X{m 27"Ţ qEc*/2'c@,:nIf#د>15wή|$D G.;E_(^z?yԗ\ OPa1nyHԆig}W$E] 3ϋ܊zխ唛hmIt%|W]\" ]{14%"y2a^6S7%ۭeSUuBЩ*+b9w!޾ ;~Z@g^Σ%m~w!fz+I7L3Trc5VÚfA^I ot\CH͂ 3uc{㷆zsl_x=VT.RD0X|D{ZԠOTQ $ 9ÞYA5h 5iP3JGM'm$.n{]ٯ R5Txgα(2c8?ɚl@0v*,ŀh` fcdh*Itu"'u{)hJ&h6pQ}Z3F3N|nZb'5/M]hmYЁ EW9Hs?fmlQj-h]oHTuKGq=2V8U?66ydܶ2;;I濠]T]utMϯ1&0]| \[J;?mgJqBLz ΍k&JghFU[ܪl;jz~-U#J"2:՟~"ݓA"GܝuRfpOJf1+l*5 <_5,0'Zm9!;m*=73z2;;>#砼L*q lvH,j-;ZPI/Br?]e5Ѧ}sc UW$3@Mo'HS5ۙIub-E/6u1P[¡mDLR >ݙO6(-ȳŹ5+N;{1&3lL>[yI!Ua7#p7h/GKBn O6+zCbl` Z9dI{E8j+ 5eLG+h i Fa n◠;5*}; 1Q|.5Q)-D10s5%-c=?{E]J.6 }rbX_aH:;,[o4rvDGz<{-thuTqOmƠ Q~JE.xIJ1왾:T=<K]ڈt+l4Sb>WGށ1u8:B3ڭnչ؅f|hq Iw{۫g p WKuC;ӵӖAm-Ci=#;F缇`nvxTxI.Œ[$}g3 #?Wњ,U ܏KIeRp8bh3Bh#5Mk;.q7a;HHe%$ܞwY9<^PpI;]VƉəcd_mǩ(D1LC~E]nEK;C\ϚɆ\.G $ kJ3v4=Ŭ$spr3)BV_`fpw /Bݡu" u6'pY9=%fvܯ̆%up}:Oa;c`'$hZݻ*fH6Ұ!2#^ow`[2җu0 ԛ9.c1:Ys[ľA? BSӌBhz rzލ@\珸bKWTUx7՝o5f p{A\^[?нk8j=Ur ^LN+F5->:xٷ#:¿ (킚3ixN)D;V:R{(;M Fon6:b(<Ő}ql{pX{[ƵAw 9/QU ͅ] =eU[o}O~M$:;Ugyt֟Fbچ s= ֡PGlʲfK-yL W`'jS%&gxfgKC}JՆS_*jtJ~X{ɡ2> IPwB?1F;R\OqsU(Ȱj܇36E-8!h/{C6%W:Ehw:uV%QlOH컫} p8fy; iwS[P$>:f~2#7D㙩}Ahm?(8ȕ]:krWb-Rȁ'S!&`% 8NɌg 0G[eM]ipIl?u @*kU9}jS A<9ODyhhlr_f-ٍi0]Z(bFZHzF}oIJrЫýH8XqtYwB(]1Dˎ֔"9K|-}-9 @׉-;Z;[A^9"U,7:B8@^k`&^Ue9BY4{NbȱViVSj2y?'2TڙR!~z"b Oas)=!i>^7_ |];I TlĠYHacsVB!T!ѪG.)~R }p;j?GG2;<5siy-+h?Xل\E Q?P1 毉YJ.t;n #," 8S%).Y:I JE[V{ώ  o~Ť H10෶HynrpJZYPjeGފQnUo&H[E㚠PӺ/8(X}TElRKOO$=}bѤ NI^A|/'4ѽ'&:䫃xi+{5?(.'J! L$GeG2ƗD>|ޜq&I1@/xfoIJ;M)3ߩ85CuHBҚUM;{J~gֻ`@(IƗ|W\/ӝf&R?b^ (Ӝ#,Ãwo@G!c2v'ȆT2M:no> Hm¹3v~4+ D>觷֮):{u8= <.z{4T)K̟>W9}k)/VmkWg˗`_K$c>לdkB=9@LG0{v:k [QGNXc+_`Ll>[)KeQw3(|eZU{ql(?4:ԫ%'<c,Om2D&v[Gb`F>fOuN.+ r-s C,>S.?Wl'x"+i,:^?[ VRݭ fZI .'PfZ&]ٌ<{0{^Q-4TOk5'qp"hX r3UW[4[Hj@~|pjƞƮ$۹WeUKnd6p14tbr#LꏞD!gvh_.'[?%{+gNҚ[ df*Ll V^ӢqZ2N(6~D˹%'FB&Cb!,V] \vc_S_ ,wz":C5I`\*al1x9&>Q΂ ߩ;<5IVSJv9wfdtu +[H3[i`.8*%g{&Tĕt3gGgR< w˥I/ȸX5˭ LؙVnws > _+^gAwnYL hcE-+zl o %ihYœ"vy"a5,a\\+KJ@y[Y}ŋeGhMiPCIw*k`0dfU2\roHV HNrG&=WD qDĄ,I#W\w,9n:,;+ܸ_ [UO!۱ae:,5F<(=ɑ^lu|LkDX1 t^p79 3Z7MMj/˨ [ ho%ǯx4Vf| j-e^UZzsRA9fokEy]V1xZ 8qBnHC x澲ٍg3/^KaTib$}Ś K~ߪ&h5C/'b/$?p)֜N0p͌H$Wu=˒Q!f1δSI"IF?Hy:Zwv'Ap>B2ƚZs[U݈ocp]nhF*X= !,s `@3%Unn 1+Bp*Ћ苳34@a-r/[Av0nk~uER;^^%9%9yuʓ a8P'>~}6Av`dI_׷wRM}暱 :ӑv *UvoLTlCsRx%Ԅ@LCD ǵ .IF%/>^&'Ւ/sB ݹۥOΊtA[ds!Jmex:4 ݹ  knRw.+6؋/[ E2Sn3' ,wg#:|6Fg<Ȏh)AG.MrUF1]ZUmcοqfnPyCֿPLuuRw׬!@cLr&kgfly~7j6wV8actK֏)M"q AhD.J$%TZ%~^ +2CA}9bcSjR% @Cy kCaS;pP2 KQJ}}-9ûP逢;A/$Cxb!ƴEJ~e$HLU;+;)SDZѐR@5Hn0$~5۪L7Z1W; qfPj0YI.}o龊Я+U&)A}Mbt\\|I/y n:"ELJ?L>S\ݔ.?ō-HX$eG #gY{C"i"l%4Hb\xӯ\VMQlc;rӿ^^3üᠸ'ez)'2Fwk)vGq$Ԋ-{{%Zg}=W+esͳ*9~0tO.S.阯x $Eԙ3%5|;PͣZ#ǧiyld,UP(Z`-`1Sj:'sh,+MIۨ p琼-_6]|LɼI e#QLO 8QeK" ; dF(|p7`z$HuB:ްyGXbķ,hlزMDϸu<|U.ȵ`]Vȼqf55^D_>:RUJ=iưGR\'~"yz5!G 8 e2xTL0/u~H|.*/ӏ}:׆ dOĚ\A=풺ڧǽ nк₢⒟#sE{j]}IS}ԅ6zĴLBيxD8"p $J, 5l|6N? G?o#LQa3=#Q$AUT)O U•FoC`v'3+,jKuPv氠 6rr(mu* 'Dp>D a/JmC>w BZ;;g ѡ3[Ă>z )K#uorb5)OO1^{.({NӲH`N )>;F d.[l_P"/͛P[D\(WnVT\G8xV~w\MQF@LߺܯKF2xWGIzw!|=H7m6.R|q8>> ?ޣWAt /{0*h&rϪ8Rs=|z|z7Kxkx]TKs*8_ZZifH0(qp C2E}ICzHYJ=-y2(52PF{B?1a8},x')25Ȧ7Yf8$ :ryo<-г~Z.A[&TDlQ/H({v?y[='x,M?H7鎣r$-A=Iyo˟:ng͖݆rͤm‘u iET}럢ap'htJctNMt~ɱ=Oא+ S ?`ma$csWŗAv+]7ctCs/qc.7#5+˦ImeDZ@!x٫ʆ& XQ[*6鵌QҠӍBys%,p|HQ˲B;3p{ -hͪςUV3cpjyKe4TŝW}sFHio6)<5X£ 7(HPhк$F@o St)T%F~vgY7X3n!,n]qa'R@u{'~LRcI1ƗCv;Gu"z0lo!O:U7wv{{gr]{OЈ9߯(uҲzݢue:=Cv5zj-s.}tz0N۷_Vye2鉄9G\ߐ[" Ku8|2&oS |@G{q^<$[Fy GK}WG0 HˠQn>ð#)L:lO[V&O@tDWPpV6+e1W;{r N}*K2Kݨs'\XHP^,.4_N댴r852Z=$y2hHTaeeդq MlYV*\Ŵ ҇Vv˙")[,8DJ;iEHʇrƝ^Zt?w~UsMr\5L<D|XؗĎX":wS=zJzRW D,9XE~)do\aa. a`C3@)>B^G$)|wȏ1L<f%aT>u &9D:s%S+2/qV-Mhe ^5g9̚{hɕqE'5()펢&P9|436ړ'yٌHzf{]Mk,fޔL]W~`w<\jR:Jjf˟`׍lLw)$ } ڴ~wzDŽXZle-݋5 0LŸX("N]0t@%j C'% {-TS(j&^ħG<IMRjWl\ЯrZAQ\_D]#PO+eGt [m=Sݜm|;Z> bab'y⽝9 '$Qޖ>PT{Ǒ ۉhïzHci'}SO5`SwXctDeǙIǞ7{ݝ+Hp[lh|fCHs LdUUQi-YÐt 4'Y#j|NS-RE ʲ7εܑÊ{!*4)9[6+3H_r-^W~p7P)jqlwQl4);>S&TLe @KRLUFտ ux RBbNg5_4wz'_6Kx=w?' Sb"K1gp4>pcT̒tӣ-d݂$O\U/G{tuLY^m_caZ#395a i1$=+ uEnB5ѲuF<6MH%)zFкQSs͚:\fLk_ƪ(ȵnϊ#ЕxZ1<0=)uS^g Bn_ ~l ir}2jÛL P.ddl溠s.uuX90RRUʘ:,bta/W ŝÈnfV /lN'՗)YKƞ"bL/H@ #<=ͳ$CDpF 1ݨoh`Umq.hvF>CS`͂CKfCL\,̏Ir~1 tEmC,h+kgFM[rT[Z5^n>v۹UoXUnEQT=p])n~:xQ(,Ըns1M! KEoO}t$+oS{ b4r^"-8JghCp~B;b,l&RP -LdpypٱEdEIv&9ԡvǺ)Uv, w${ 瑲YI\p1I0'Fd|at[O5 qiX)7ɡ:QxP~Q)T [\ 4|kaS&ρarL qb׈dFi M)$~M4>;X%Q x3=r4M5`>YB9'+tp. Er~(LKvs:(Cgŭ 17r _Baa-wʓ54DM*U3Y+ f@&F5d(Ly2CK&=ѫ=rqۭ^%i cVpzl?0ХE"OXn6oK !5.ۢH->!  D.bKj~%dd[!:tFbETХeUŸj\ԥih{ }AR4UyC38XۿQagg 6t΁=!N}촞](T9aoRXkĠ{ :Ǎ G}ң=qqzjJ<`;*A $δBCF2$ˠMFyI;{ `"LS~JbhԳؓ5CIu)-ãT|c ` 11{3fc)o{чR֭=gYZ.shstrtab.note.gnu.property.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata  $1oD; 88C Ko((Xo**8go**v,,0BGG`` ` `nnp}p}(  :":"J""s%s%s%s%s%s%Q &&(&(&&&`/ `&`&a `&4&o(o'!